KEGG   Methylococcus capsulatus: MCA0561Help
Entry
MCA0561           CDS       T00205                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mca  Methylococcus capsulatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCA0561 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCA0561 (glk)
   00052 Galactose metabolism
    MCA0561 (glk)
   00500 Starch and sucrose metabolism
    MCA0561 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MCA0561 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCA0561 (glk)
   00524 Butirosin and neomycin biosynthesis
    MCA0561 (glk)
Enzymes [BR:mca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MCA0561 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
590296..591288
Genome map
AA seq 330 aa AA seqDB search
MLLAGDVGATKTVLGLFDCWGDRLVSLSEAIFASTDYASLETVVAAFLDGQEERRPEVAC
FGVPGPVSEGRCEITNLPWVLSERELAAATGVSAVRLLNDVQAMALGMAYRLGEDDWVEL
NPGAGRPRSGNVAVIAAGTGLGEAILYWDGERYHALPTEGGHSDFAPNGPLEEGLLAFLR
DRFCGHVSYERILSGSGLANLYDYLRHAGVAPESEALHAALASAPDRAPIIAEWALERRD
ALCTAVLDLFAAIYGAEAGNLALKSLALGGVILGGGIAPKILPVLQAGRFMAAFTAKGRL
SPLLGRLPVRVAIHPQPALLGAAHAASAML
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctggcgggggacgtcggcgctaccaagacggtcctcgggctgttcgactgctgg
ggcgacaggctggtcagtctgagcgaggcgattttcgccagcacggactatgcctcgctg
gagacggtggtggcggcgttcctggatgggcaggaggaacggaggcccgaagtcgcctgt
ttcggggtgccgggaccggtgagcgaaggccgctgcgaaatcaccaacctgccgtgggtt
ctgtccgagcgggaacttgcggcggcgacgggggtgagtgcagtgcgcctgctgaacgac
gtccaggccatggccctgggcatggcttaccggttgggcgaggacgattgggtggagctg
aaccccggcgccggccgtccgcgatccggaaacgtcgcggtgatcgccgcggggacggga
ttgggcgaggccatcctgtattgggatggcgagcgctaccatgcgctgccgaccgaaggc
ggacacagcgatttcgcccccaacggaccgctggaagaagggttgctcgccttcctgcgg
gatcgcttctgcgggcatgtcagctacgagcggatactgtctggttcggggctggccaat
ctctacgactatctgcgtcacgccggcgtggcgccggaaagcgaggcactgcacgccgcc
ctggccagcgctcccgaccgtgccccgatcatcgccgagtgggcactggaacggcgtgac
gccctttgcaccgcggtgctcgatctcttcgcggcaatctacggggcggaagccgggaat
ctggccctcaagtcgctcgcgctcggtggcgtgatcctgggcgggggtatcgcgccgaaa
atccttccggtcctgcaggcggggaggttcatggccgctttcacggcaaagggaaggctg
tcccccctcctggggcggcttcccgtgcgggtcgccatccatccccagccggccctgctg
ggggcggcgcatgccgcctcggccatgctttga

DBGET integrated database retrieval system