KEGG   Methylococcus capsulatus: MCA0575Help
Entry
MCA0575           CDS       T00205                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mca  Methylococcus capsulatus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
604619..605251
Genome map
AA seq 210 aa AA seqDB search
MKPDSIKPSPLAGISEVIVGPKLFYVSDDGKYLFQGSLIDLKNREDLTEPKLATARLGAL
EKLGEKNMIVFKPKIGKYVAYVFTDIDCGYCRKLHSELDSYLKEGIEIRYLFFPRAGEGS
ESWDKAVNVWCAKDRNAALTKAKKGEKVEERTCDNPIKEQMALGTAIGAQGTPMIVTGGG
NVLPGYVPAEQLARMLKHEKDEGGRQARTP
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgattccatcaagccgtcgccgctggccggcatttccgaggtcatcgtcggt
cccaagctgttctatgtctccgacgacggcaaatacctgttccagggctcgctgatcgat
ctcaagaaccgggaagacctgaccgaacccaaactcgccacggcccggctcggggcgctg
gaaaagctgggcgagaagaacatgatcgtgttcaaacccaagatcggcaagtacgtggcc
tacgtcttcaccgacattgattgcggttactgccgcaaactccattcggagctggacagc
tatctcaaggaaggcatcgagatccgttacctgttctttccgcgtgccggcgagggttcg
gagtcctgggacaaagcggtcaacgtgtggtgcgccaaggatcgcaacgctgccttgacc
aaggccaagaagggcgagaaggtggaagaaaggacctgcgacaatcccatcaaggagcag
atggcgctgggaaccgccatcggtgctcagggcacgccgatgatcgtcaccggcggcggc
aacgtgttgccgggctacgttccggccgagcagctcgcccgcatgctcaagcatgaaaag
gatgagggcggcaggcaggcgaggacgccctga

DBGET integrated database retrieval system