KEGG   Methylococcus capsulatus: MCA0596Help
Entry
MCA0596           CDS       T00205                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mca  Methylococcus capsulatus
Pathway
mca00260  Glycine, serine and threonine metabolism
mca00750  Vitamin B6 metabolism
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
mca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCA0596 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCA0596 (thrC)
Enzymes [BR:mca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MCA0596 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AAU93151
UniProt: Q60B84
Position
complement(627857..628999)
Genome map
AA seq 380 aa AA seqDB search
MTMTTRYTGLIERYRDRLPVSAETRIISLGEGDTPLIRLENIPRLLGRRVELYVKYEGLN
PTGSFKDRGMTMAVTRAVEEGSRAIICASTGNTSAAAAAYAARAGITAFVLIPDGKIAMG
KLAQAMMYGSVVIQIKGNFDDGMRLVKEVAGEAPVTIVNSINPYRLQGQKTAAFEIVDEL
GRAPDYHCLPVGNAGNITAHWIGYSEYACGGRDCVTEACAFCNGECRFVSGGPVSTSRPK
MVGYQASGSAPFLRGHMVDHPETVATAIRIGHPQSWEQAWQVSRESGGWFDECSDEEILA
AQKLLTEREGVFCEPASATSLAGALRDIRSGKIPEGSTVVLTLTGNGLKDPDTAIAQCTQ
KPVTIEAELDSVKRAILDAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgacacgctacaccggcctcatcgaacgctaccgagaccgcctcccggtc
agtgcggagacccgcatcatcagtctgggtgaaggcgacaccccgttgatccgtctggaa
aacatcccccgcctgctgggcaggcgcgtcgagctctacgtgaagtacgaggggctcaac
ccgaccggctcgttcaaggaccgtggcatgaccatggccgtgacccgggcggtcgaggaa
ggcagccgcgccatcatctgcgcatccaccggcaacaccagcgccgccgccgccgcctat
gccgcccgcgccggcatcaccgccttcgtactgatcccggacggcaagatcgccatgggc
aagctggcccaggccatgatgtacggttcggtggtgatccagatcaagggcaatttcgac
gacggcatgcggctggtcaaggaagtggccggggaagcgcccgtcaccatcgtcaactcg
atcaatccctaccggctgcagggccagaagaccgcggccttcgagatcgtcgacgaactc
ggccgggccccggactaccactgcctgccggtcggcaacgccggcaacatcacggcgcat
tggatcggctacagcgaatacgcctgcggcgggcgcgactgcgtgaccgaggcctgcgcg
ttctgcaacggcgaatgccgcttcgtgagcggcgggccggtctcgaccagccggccgaag
atggtcggctatcaagccagcggctcggcgccgttcctgcgcggccacatggtggaccat
ccggagacggtggcaaccgccatccgcatcggccatccgcaaagctgggagcaggcctgg
caggtcagccgcgaatccggcggctggttcgacgaatgcagcgacgaggaaatcctggcc
gcccagaagctgctgaccgaacgcgaaggcgtcttctgcgagccggcctcggcgacttcc
ctggccggcgccctgcgcgacatccggagcggcaagatccccgaaggcagcaccgtggtg
ctgaccttgacgggcaacggcctcaaggaccccgataccgccatcgcccagtgcacccag
aagcccgtcaccatcgaagccgagctggactcggtcaagcgggccattctcgacgcgctc
tga

DBGET integrated database retrieval system