KEGG   Methylococcus capsulatus: MCA0596Help
Entry
MCA0596           CDS       T00205                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mca  Methylococcus capsulatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCA0596 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCA0596 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCA0596 (thrC)
Enzymes [BR:mca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MCA0596 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(627857..628999)
Genome map
AA seq 380 aa AA seqDB search
MTMTTRYTGLIERYRDRLPVSAETRIISLGEGDTPLIRLENIPRLLGRRVELYVKYEGLN
PTGSFKDRGMTMAVTRAVEEGSRAIICASTGNTSAAAAAYAARAGITAFVLIPDGKIAMG
KLAQAMMYGSVVIQIKGNFDDGMRLVKEVAGEAPVTIVNSINPYRLQGQKTAAFEIVDEL
GRAPDYHCLPVGNAGNITAHWIGYSEYACGGRDCVTEACAFCNGECRFVSGGPVSTSRPK
MVGYQASGSAPFLRGHMVDHPETVATAIRIGHPQSWEQAWQVSRESGGWFDECSDEEILA
AQKLLTEREGVFCEPASATSLAGALRDIRSGKIPEGSTVVLTLTGNGLKDPDTAIAQCTQ
KPVTIEAELDSVKRAILDAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgacacgctacaccggcctcatcgaacgctaccgagaccgcctcccggtc
agtgcggagacccgcatcatcagtctgggtgaaggcgacaccccgttgatccgtctggaa
aacatcccccgcctgctgggcaggcgcgtcgagctctacgtgaagtacgaggggctcaac
ccgaccggctcgttcaaggaccgtggcatgaccatggccgtgacccgggcggtcgaggaa
ggcagccgcgccatcatctgcgcatccaccggcaacaccagcgccgccgccgccgcctat
gccgcccgcgccggcatcaccgccttcgtactgatcccggacggcaagatcgccatgggc
aagctggcccaggccatgatgtacggttcggtggtgatccagatcaagggcaatttcgac
gacggcatgcggctggtcaaggaagtggccggggaagcgcccgtcaccatcgtcaactcg
atcaatccctaccggctgcagggccagaagaccgcggccttcgagatcgtcgacgaactc
ggccgggccccggactaccactgcctgccggtcggcaacgccggcaacatcacggcgcat
tggatcggctacagcgaatacgcctgcggcgggcgcgactgcgtgaccgaggcctgcgcg
ttctgcaacggcgaatgccgcttcgtgagcggcgggccggtctcgaccagccggccgaag
atggtcggctatcaagccagcggctcggcgccgttcctgcgcggccacatggtggaccat
ccggagacggtggcaaccgccatccgcatcggccatccgcaaagctgggagcaggcctgg
caggtcagccgcgaatccggcggctggttcgacgaatgcagcgacgaggaaatcctggcc
gcccagaagctgctgaccgaacgcgaaggcgtcttctgcgagccggcctcggcgacttcc
ctggccggcgccctgcgcgacatccggagcggcaagatccccgaaggcagcaccgtggtg
ctgaccttgacgggcaacggcctcaaggaccccgataccgccatcgcccagtgcacccag
aagcccgtcaccatcgaagccgagctggactcggtcaagcgggccattctcgacgcgctc
tga

DBGET integrated database retrieval system