KEGG   Methylococcus capsulatus: MCA0674Help
Entry
MCA0674           CDS       T00205                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mca  Methylococcus capsulatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCA0674 (tpiA)
   01230 Biosynthesis of amino acids
    MCA0674 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCA0674 (tpiA)
   00051 Fructose and mannose metabolism
    MCA0674 (tpiA)
   00562 Inositol phosphate metabolism
    MCA0674 (tpiA)
Enzymes [BR:mca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCA0674 (tpiA)
Exosome [BR:mca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCA0674 (tpiA)
  Exosomal proteins of bladder cancer cells
   MCA0674 (tpiA)
  Exosomal proteins of melanoma cells
   MCA0674 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
707879..708631
Genome map
AA seq 250 aa AA seqDB search
MRRPLVVGNWKMNGRSASVARLLNDILAGIGDCKAEVGVCVPFVYIPQASEILKGTKVML
GAQNVADHNSGAFTGEISAGMLREFGCELAIVGHSERRLLYGESNELVASRYEQAIQGHL
KPILCVGETLEQREQGRTLAVIGAQIDTVFEFAGVQSLEHAVIAYEPVWAVGTGRSATTG
QAQEVHYHIRSLIARWNPEVAQAVQIIYGGSVKPENSAELFAMPDIDGGLIGGASLDARA
FLSICHSVSV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctctggtggttggaaactggaagatgaacggcaggagcgcgagcgtggct
cgcctgctgaacgacatcctggccggcatcggagactgtaaggcagaagtcggggtgtgc
gtgccgttcgtttacatcccccaggcatccgagatactgaagggcaccaaggtgatgctg
ggtgcgcagaacgtcgcggaccacaactccggcgcgttcaccggcgagatttcagccggc
atgctgcgcgagttcggctgtgagctggccatcgtcgggcactcggaacggcgtctgctc
tatggcgagtcgaacgaactcgtggcgtcccgctacgaacaggcgatccagggacatctc
aaaccgatcctctgcgtcggcgaaacgctggagcagagggagcagggcaggacccttgcg
gtgatcggggcgcagatcgacaccgtgttcgaattcgccggcgtccagtccctggagcat
gcggtgatcgcttacgagccggtttgggccgtcgggaccgggcgcagcgcgaccaccggc
caggcccaggaggtgcactatcacatccggagtttgatcgcccggtggaatccggaagtg
gctcaggcggtgcagattatctatggtggaagcgtgaagccggagaattccgctgaattg
tttgcgatgcccgacatcgatggcggcctgatcggcggtgcctcgctcgatgcgcgggcg
tttctgtcgatctgtcattcagtttcagtttag

DBGET integrated database retrieval system