KEGG   Methylococcus capsulatus: MCA0692Help
Entry
MCA0692           CDS       T00205                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mca  Methylococcus capsulatus
Pathway
mca03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCA0692 (recD)
Enzymes [BR:mca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCA0692 (recD)
DNA repair and recombination proteins [BR:mca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MCA0692 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 UvrD-helicase DUF2075 UvrD_C AAA_28 AAA_22 AAA_16 AAA_25 CbiA Cas_GSU0054 AAA_33 DEAD T2SSE
Motif
Other DBs
NCBI-ProteinID: AAU93176
UniProt: Q60AZ4
Position
726869..728680
Genome map
AA seq 603 aa AA seqDB search
MSAGESGYSSEHLLAAGFARRCLRWAKDPAAPGVLERAAFLASFATTDGHVCTDLAELAE
DFPQHGPDLLRTLLLGSGVVGTPGGEPRPLVLDDEGRLYLYRYFDYERRLASALQRLARG
RDSLTPPSEAVREQLNALFPPASGGPDWQKLAAALALLGRLTVISGGPGTGKTTTVVNLL
ACLLVQNPDCRIALAAPTGKAAARMLDALRERAAHLPGSLREKLPAAASTVHRLLGVIPG
SGNFRHHAGNPLAVDVLVVDEASMLDLGLATRLVEAVPVDGRLILLGDKDQLAAVEAGAV
FAELSADPRLSPPVIERLAALTQTDPAAIVTAAPVRSTPLEDCVVWFSRNYRFRSDSGIG
RLAARVNSGEADAVIAELRAGGESGVIWQEDGAAAPGAGLIETLLAGYADYLDVMRSGQA
APAAVFAAYNRFRILCAVRESPRGVEAINRLIAREFRRRLGLGADERAEWYPGRPVMVLR
NDYVLKLFNGDTGIVLADPSGELRVHFPDAGGGFRAIPPARLPEHETAFALTVHKSQGSE
FDEVALLLPDRISPVLTRELVYTGITRARRAVSLVGAAPVLAEAIRRRTRRHSGLIARLE
EIG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccggcgaatccggctactcttccgagcatctgctggccgccggcttcgcccgt
cgctgtctgcgctgggcgaaggacccggcggcgcccggggtgttggagcgggccgctttc
ctggccagtttcgccaccaccgacggtcatgtctgcaccgatctggccgaattggccgaa
gacttcccgcagcacggcccggacttgttgcggacgctgctgcttggttccggcgtggtc
ggcacgccggggggcgaaccccgcccgctggtcctggatgacgaagggcggctctatctt
taccgctatttcgactatgagcgtcgcctggcatctgctttgcagcggctggcgcgcggc
cgtgacagtctgacgccaccgtcggaagcggtgcgggagcagttgaacgctttgtttcct
cccgcatccggcggccccgactggcagaagctcgccgccgccctggccctgctgggccgg
ctcaccgtcatcagcggcgggccgggcaccggcaagaccaccacggtggtgaacctgctg
gcctgtctgctcgtccagaatccggactgccgcatcgccctggccgcgcccactggcaag
gccgcggcccgcatgctggatgcgttgcgtgagcgggcggcgcatctgcccgggtctctc
agggagaaacttccggccgccgccagtaccgttcaccgtctgctgggcgtgattccgggc
agcggaaattttcgccatcatgccgggaatcccttggccgtcgacgtgctggtggtcgac
gaggcgtcgatgctcgacctgggactggccacccggctggtcgaagcggtgcccgtcgac
ggccggctgatcctgctgggcgacaaggaccagctcgccgccgtggaggcgggggcggtg
ttcgccgaactcagcgccgacccacggctgtcaccgccggtcatcgagcgtctggcagcc
ctgacccagaccgatccggcggccatcgtcactgccgcgcccgtccgttccactccgctc
gaggattgtgtggtctggttcagccgcaactaccgtttccgcagcgattccggtattgga
cggctggcggcgcgggtcaactcgggcgaagcggatgcagtgatcgcggaattgcgggcc
ggcggagagagcggcgtgatctggcaggaggacggggccgccgcgcccggcgccggcctg
atcgagaccctgctggcgggctatgcggattacctggatgtcatgcgatccggccaggct
gcgccggcagccgtgttcgccgcctacaaccgtttccgcatcctgtgcgcggtgcgggaa
tccccgcgcggggtggaggcgatcaaccggctgatcgcccgggaatttcgccgccgcctc
ggtctgggagcggacgaacgggccgaatggtatcctggtcggccagtgatggttctgcgc
aacgactacgtgctgaagctgttcaacggcgacaccggcatcgttctggcggacccctcc
ggagaactgcgggtgcattttcccgatgccggcggcggattccgcgccatccccccggcc
aggctgcccgagcacgagaccgcattcgccctgaccgtgcacaaatcgcagggatcggag
ttcgacgaggtggcgctgctgttgccggaccgtatctcgccggtcctcacccgagagctg
gtttacaccggtattacccgcgccaggcgcgcggtatccctcgtcggcgccgcgccggtg
ctggcggaggccatccgccgccgcacccgccgccattccgggctgatcgcccgtctggaa
gagattgggtga

DBGET integrated database retrieval system