KEGG   Methylococcus capsulatus: MCA0692Help
Entry
MCA0692           CDS       T00205                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mca  Methylococcus capsulatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCA0692 (recD)
Enzymes [BR:mca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCA0692 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726869..728680
Genome map
AA seq 603 aa AA seqDB search
MSAGESGYSSEHLLAAGFARRCLRWAKDPAAPGVLERAAFLASFATTDGHVCTDLAELAE
DFPQHGPDLLRTLLLGSGVVGTPGGEPRPLVLDDEGRLYLYRYFDYERRLASALQRLARG
RDSLTPPSEAVREQLNALFPPASGGPDWQKLAAALALLGRLTVISGGPGTGKTTTVVNLL
ACLLVQNPDCRIALAAPTGKAAARMLDALRERAAHLPGSLREKLPAAASTVHRLLGVIPG
SGNFRHHAGNPLAVDVLVVDEASMLDLGLATRLVEAVPVDGRLILLGDKDQLAAVEAGAV
FAELSADPRLSPPVIERLAALTQTDPAAIVTAAPVRSTPLEDCVVWFSRNYRFRSDSGIG
RLAARVNSGEADAVIAELRAGGESGVIWQEDGAAAPGAGLIETLLAGYADYLDVMRSGQA
APAAVFAAYNRFRILCAVRESPRGVEAINRLIAREFRRRLGLGADERAEWYPGRPVMVLR
NDYVLKLFNGDTGIVLADPSGELRVHFPDAGGGFRAIPPARLPEHETAFALTVHKSQGSE
FDEVALLLPDRISPVLTRELVYTGITRARRAVSLVGAAPVLAEAIRRRTRRHSGLIARLE
EIG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccggcgaatccggctactcttccgagcatctgctggccgccggcttcgcccgt
cgctgtctgcgctgggcgaaggacccggcggcgcccggggtgttggagcgggccgctttc
ctggccagtttcgccaccaccgacggtcatgtctgcaccgatctggccgaattggccgaa
gacttcccgcagcacggcccggacttgttgcggacgctgctgcttggttccggcgtggtc
ggcacgccggggggcgaaccccgcccgctggtcctggatgacgaagggcggctctatctt
taccgctatttcgactatgagcgtcgcctggcatctgctttgcagcggctggcgcgcggc
cgtgacagtctgacgccaccgtcggaagcggtgcgggagcagttgaacgctttgtttcct
cccgcatccggcggccccgactggcagaagctcgccgccgccctggccctgctgggccgg
ctcaccgtcatcagcggcgggccgggcaccggcaagaccaccacggtggtgaacctgctg
gcctgtctgctcgtccagaatccggactgccgcatcgccctggccgcgcccactggcaag
gccgcggcccgcatgctggatgcgttgcgtgagcgggcggcgcatctgcccgggtctctc
agggagaaacttccggccgccgccagtaccgttcaccgtctgctgggcgtgattccgggc
agcggaaattttcgccatcatgccgggaatcccttggccgtcgacgtgctggtggtcgac
gaggcgtcgatgctcgacctgggactggccacccggctggtcgaagcggtgcccgtcgac
ggccggctgatcctgctgggcgacaaggaccagctcgccgccgtggaggcgggggcggtg
ttcgccgaactcagcgccgacccacggctgtcaccgccggtcatcgagcgtctggcagcc
ctgacccagaccgatccggcggccatcgtcactgccgcgcccgtccgttccactccgctc
gaggattgtgtggtctggttcagccgcaactaccgtttccgcagcgattccggtattgga
cggctggcggcgcgggtcaactcgggcgaagcggatgcagtgatcgcggaattgcgggcc
ggcggagagagcggcgtgatctggcaggaggacggggccgccgcgcccggcgccggcctg
atcgagaccctgctggcgggctatgcggattacctggatgtcatgcgatccggccaggct
gcgccggcagccgtgttcgccgcctacaaccgtttccgcatcctgtgcgcggtgcgggaa
tccccgcgcggggtggaggcgatcaaccggctgatcgcccgggaatttcgccgccgcctc
ggtctgggagcggacgaacgggccgaatggtatcctggtcggccagtgatggttctgcgc
aacgactacgtgctgaagctgttcaacggcgacaccggcatcgttctggcggacccctcc
ggagaactgcgggtgcattttcccgatgccggcggcggattccgcgccatccccccggcc
aggctgcccgagcacgagaccgcattcgccctgaccgtgcacaaatcgcagggatcggag
ttcgacgaggtggcgctgctgttgccggaccgtatctcgccggtcctcacccgagagctg
gtttacaccggtattacccgcgccaggcgcgcggtatccctcgtcggcgccgcgccggtg
ctggcggaggccatccgccgccgcacccgccgccattccgggctgatcgcccgtctggaa
gagattgggtga

DBGET integrated database retrieval system