KEGG   Methylococcus capsulatus: MCA0775Help
Entry
MCA0775           CDS       T00205                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mca  Methylococcus capsulatus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MCA0775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCA0775
  Lipid metabolism
   00071 Fatty acid degradation
    MCA0775
  Amino acid metabolism
   00350 Tyrosine metabolism
    MCA0775
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MCA0775
   00626 Naphthalene degradation
    MCA0775
Enzymes [BR:mca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MCA0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
819413..820441
Genome map
AA seq 342 aa AA seqDB search
MKAWVIDRIGPLDSSRTLLRATDLPVPEPGPGEILLQVAVCGVCHTEIDEIEGRTAPPRL
PVVPGHQAVGRIAALGSGVAEFALGDRVGVAWIFSACGECEFCRSGRENLCFAFCATGRD
VDGGYAQYMTVPAAFAFRIPEGFTDAEAAPLLCAGAIGYRSLNLSGLKNGQPLGLTGFGA
SAHLVLMMARYRFPDSEVYVFARHPEERAFALQLGAVWAGDTADIAPAPLAAIIDTTPAW
KPVVAALANLAPGGRLVVNAIRKAPDDRACLAELDYARHLWMEREIKSVANVARSDVAGF
LALAAEMGIRPETEEYPFEDADRALLDLKQRRIRGAKVLRVT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttgggtgatcgaccgaatcggcccgctggactcgtcgcgaactctgctacgc
gccaccgacctcccggtgccggagcccggccctggcgaaatcctgctgcaggtggcggtt
tgcggcgtctgccacaccgaaatcgacgagatcgagggccgcaccgcgccgccgcgcctg
ccggtcgtgcccggacaccaagcggtcggtcggatcgcggctctcggctccggcgtggcg
gaattcgctttgggcgaccgcgtcggcgtggcctggatcttttctgcctgcggagaatgc
gaattctgccggtcgggacgggagaacctctgtttcgcattctgtgccaccgggcgcgat
gtcgacggcggctacgcccagtacatgaccgtcccggcggcctttgctttccgcattccg
gagggattcaccgatgccgaagcggcgccgcttctgtgcgccggcgccatcggttaccgt
tcgctcaatctcagcgggctgaaaaacggccagccgctggggctcaccgggttcggggct
tccgcccatctggtgctgatgatggcccggtaccggtttcccgattcggaagtctatgtc
tttgcgcgtcatcccgaggagcgcgcgttcgcgctgcagctgggcgcggtctgggccggc
gacaccgcggacattgctcccgccccgctggccgccatcatcgacacgacgccggcgtgg
aagccggtggtcgcagcgctcgccaacctcgctcccggtggccggctggtcgttaatgcg
atccgcaaggcgccggacgatcgcgcctgtctcgccgaactcgactatgcccggcacttg
tggatggaacgggaaatcaagtcggtcgccaacgtggcgcgcagtgacgtggccgggttc
ctggcgctggcggcggaaatgggcatccgtcccgagacggaggagtacccgttcgaggat
gccgaccgggcgctgctcgacctcaagcaacgccggattcgcggggcgaaggtgttgcgg
gtgacttga

DBGET integrated database retrieval system