KEGG   Methylococcus capsulatus: MCA0798Help
Entry
MCA0798           CDS       T00205                                 

Definition
ARD/ARD' family dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mca  Methylococcus capsulatus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mca00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(838796..839356)
Genome map
AA seq 186 aa AA seqDB search
MSLLTIHPESGTSAPEIIREGDAIAARLAEIGVLFERWQAGRAFEPDAEQQTILAAYADS
VERLKAKYGFESADVISVGPDHPQKDELRARFLREHTHSDFEVRFFVEGRGLFYLHPGDR
VYAILCERGDLLSVPSNTRHWFDMGAEPCLKCIRLFTTAEGWVADFTGSDIGDRFPRLED
YLKHYA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagccttctgaccatacaccccgagtccggaacctcggcgccggagatcatccgcgaa
ggcgatgccatcgccgcacggctggccgaaatcggcgttttgttcgagcgctggcaagcg
ggccgggcattcgaaccggatgccgagcagcagacgatccttgcggcttacgccgattcg
gtcgaacgcctgaaggcgaaatacggtttcgaatcggccgacgtcatcagcgtcggcccc
gatcatccgcagaaggacgaactgcgggcgcgcttcctgagggagcatactcacagcgat
ttcgaagttcgcttcttcgtcgaaggccgcggcctgttctacctccaccccggcgaccgc
gtctacgccatcctgtgcgagcggggcgacctcctgagcgtcccttcgaatacccgccac
tggttcgacatgggcgccgaaccctgcctgaagtgcatccggctgttcaccaccgcggaa
ggctgggtcgccgatttcaccggtagtgacatcggcgaccgcttcccccggcttgaggat
tacctgaagcattacgcatga

DBGET integrated database retrieval system