KEGG   Methylococcus capsulatus: MCA0941Help
Entry
MCA0941           CDS       T00205                                 

Definition
glycosyl hydrolase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mca  Methylococcus capsulatus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MCA0941
Enzymes [BR:mca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MCA0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(983200..985626)
Genome map
AA seq 808 aa AA seqDB search
MIELRDKTILIDGRPRLVLSGEVHYFRLRREDWQDRLDKLKAAGCNTVASYIPWLCHETV
EGRIDLDGRSRPELDLGAFIDLCRANGLWFIARPGPFVMAELKNEGLPYWLYEKHPEIVP
VGWDGKPATTHTVDYLAPGFLDAARRWYDAVMAVITPRLQPGGGNVIALQLDNEIGMLSW
LSNCPDLTENVLADFAAWLKVRHRPESLRKRYPFDPDEPEARRAGIRSPAESYALALLRD
LGHYMRDRFARYVATLRSWAETAGIRGIPFVVNIHGTGGGRALSFPIGISQLYPSYTQDF
GYLSGSDFYLGNLTFDNFQDLYLCNAFMEAVHRPEQPLASMEFECGDGNYGNTYGNRLDP
SAADFKARMCLAQGARLLNYYLFTGGHNYRLDPPPPDGDGRIAFTGERHGFAAPVDPDGR
LNYSYPRLANLTRTVAAVADKLAAMWEEHDRVAFGFIPDYFMTESRHPASAAMATIVRNL
EANRGPSAWETMARAMLLGGYRFGAVDLQNRPLDVKTTPVLALGSARYMDTAVQRKLADW
LSAGGGLLLYGEVPLYGMEGEPCTLLAEALGTEISGFRQASERYFLALAADGWARPRPEV
RSHFAQTFAAPLAEALLRVCDTGEICGFETAVGKGRAVVIGTAYPCDIALFRTALERLGA
VAALRHDCENHGIFMTSTANAAGERFIHLLNLDGFDKRFHLYEHGRPLFDGHEIELRARD
GVMLPLAMRFGEVKIEYATAEITAVSPDRIEFRATRRRGVIAVETARKLRVSPPCELRQD
GPTTYGVLLRPAPHHDRIILCHERTGDG
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaactccgcgacaagaccatcctgatcgacggccggccccgtctggtgctgagc
ggcgaggtgcattatttccgcctccggcgcgaagactggcaggaccggctggacaagctc
aaagccgccggctgcaacaccgtcgcctcctatattccctggctctgccatgaaaccgtc
gagggccggatcgacctcgacgggcgctcccgcccggaactggatctcggcgccttcatc
gatctgtgccgggccaacggcctttggttcatcgcccgtcccggccccttcgtgatggcc
gagctgaagaacgaaggcctgccttactggctttacgaaaagcatcccgaaatcgtgccc
gtaggctgggacggcaagccggcgaccacccacacggtcgattacctggcacccggcttc
ctggatgcagcccgccgctggtacgacgcggtgatggcggtgatcacaccacgcctgcag
ccgggcggcggcaacgtgatcgcgctgcagctcgacaacgagatcggcatgctgtcctgg
ctcagtaactgcccggacctcaccgaaaacgtgctggcggatttcgcggcctggctgaaa
gtccgtcaccgccctgagagcttgcggaaacgctaccccttcgacccggatgagccagag
gcgcgccgcgccggcatccgctcgcccgccgagagctacgccctggccctcctgcgcgac
ctcggccactacatgcgcgaccgtttcgcccgctacgtcgcaaccctgcggtcctgggcg
gaaaccgccggcatccgcggcatccccttcgtggtcaatatccatggcaccggcggcggc
cgtgccctaagcttcccgatcggcatcagccagctctacccgtcctacacccaggatttc
ggctacctgtcgggctccgacttctatctcggtaatctgacgttcgacaacttccaggac
ttgtatctctgcaacgccttcatggaggccgtgcaccgccccgaacagcctctggcttcg
atggagttcgaatgcggcgacggcaactacggcaacacctatggcaaccggctggatccc
tccgccgccgacttcaaggcgcgcatgtgcctggcccagggcgcacggctcctcaactac
tacctcttcacgggcggccacaactaccggctcgacccgccgccgccggacggcgacggc
cgcatcgccttcaccggcgaacgccacggtttcgccgcgccggtcgatccggacggacgg
ttgaattacagctatccgcgcctggcgaacctgacccgcaccgtggccgctgttgccgac
aagctggccgccatgtgggaggagcacgaccgggtggccttcggcttcattcccgactat
ttcatgacggaatcccgccatcccgccagtgccgcgatggccaccatcgtccgcaatctg
gaagccaaccgcgggccaagcgcctgggagaccatggcccgagcgatgctgctcggcggc
taccgcttcggcgcggtggacctccagaaccggccgctcgacgtgaagaccacaccggtg
ctggcgctgggctcggcccggtacatggacaccgccgtccagcgcaagctggccgattgg
ctgagtgcgggcgggggcctgctgttgtacggggaagtccccctgtacgggatggagggc
gagccctgcacgctgctggccgaagcgttgggcaccgaaatttcagggtttcgccaggcc
agtgagcgctatttcctcgcgctggccgcggacggctgggccaggccgcgaccggaagta
cgcagccatttcgcccagactttcgctgctcctttggccgaagcgctgctgcgggtttgc
gacaccggcgagatctgcggcttcgaaacggcggtcgggaaaggccgcgccgtcgtcatc
ggcaccgcctacccttgcgacatcgccctgttccgcaccgccttggaacggctgggcgca
gtcgccgccttgcgccacgactgcgaaaaccacggcatcttcatgacgtcgaccgccaac
gccgcgggagagcgcttcatccacctgctgaacctggacggcttcgacaagcgtttccat
ctttacgagcacggccgaccgctgttcgacggacacgaaatcgagcttcgcgcccgcgac
ggtgtgatgctgccgctggccatgcgtttcggtgaagtgaagatcgagtacgccaccgcg
gaaatcaccgccgtgagcccagaccgcatcgaattccgcgcgacccggcggcggggcgtg
atcgccgtcgagacagcccgcaagctgcgggtctcccccccatgcgaactgcgccaggac
ggcccgacgacttacggggtattgctgcgcccggctccccatcatgaccggatcatcctg
tgccatgaacgcaccggcgacggctga

DBGET integrated database retrieval system