KEGG   Methylococcus capsulatus: MCA1017Help
Entry
MCA1017           CDS       T00205                                 

Definition
nucleoside diphosphate sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mca  Methylococcus capsulatus
Brite
Enzymes [BR:mca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     MCA1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1068621..1069607
Genome map
AA seq 328 aa AA seqDB search
MTTLVTGATGHLGANLVRALLARGEKVRAFIRRQSDVAALDGLAVERAYGDLRDRRSIRD
ALEGVERLYHTAAFVSIRDGDRQELFDVNVVGTRMLMQEARRAGVRRVVHTSSFGAVGIN
PQGASNEHWTVSPFEPGTDYERTKAVSEHDVILEAVRGLDVTIVNPAAIVGPWDFRPSLV
GRTILDFAHGRMRAFVPGAFDFVPMRDVVAVELLAMDKGIRGERYLVTGEHCTIGQILQW
LEELTGHPRPRLAIPPRLMQGIALLKDPLERRFFPRRTPRFNYHSIRLLNSGKRGDSSRS
RRELGLVPTSTRAAFADAVAWFRERGMI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactggtcaccggcgccaccggccatctcggcgccaatctggttcgggcgctg
ctggcccggggcgagaaggtgcgcgccttcatccgccgacaaagtgacgtcgcggcgttg
gacggcttggcggtcgaacgggcctacggcgatctgcgcgaccgccgctcgatccgggac
gcgctggaaggcgtggagcggttgtaccacaccgcggccttcgtcagtatccgcgacggt
gaccgccaggagctgttcgacgtcaacgtggtcggcactcgcatgctgatgcaggaggcg
cggcgggccggcgtgcgtcgggtggtgcataccagctccttcggcgcggtcggcatcaac
ccccaaggcgcatcgaacgaacactggacagtcagcccgttcgaaccgggcaccgactac
gaacggaccaaggccgtgtcggaacacgacgtgatcctcgaagccgtgcgcggcctcgac
gtgaccatcgtcaacccggccgcgatcgtcggtccgtgggatttccggcccagcctggtc
ggccgtaccatcctcgacttcgcccatggccggatgagggcgttcgttcccggtgccttc
gacttcgtcccgatgcgcgacgtggtggctgtggaactgctggccatggacaaaggcatc
cgcggtgagcgctatctcgtcaccggcgagcactgcaccatcggtcagatactgcaatgg
ctggaggagctgaccgggcatccgcgtccgaggctcgcgatcccgccgcgcctcatgcag
ggcatcgcactgctgaaggacccgctggaacgccgttttttcccccgccggacgccacgc
ttcaactaccactccatccgcctgctcaactcgggcaagcgcggcgattcctcacggagc
cggcgcgaactgggcctggtcccgacttccacccgggcggctttcgccgacgccgtggcc
tggttcagggagagggggatgatctga

DBGET integrated database retrieval system