KEGG   Methylococcus capsulatus: MCA1211Help
Entry
MCA1211           CDS       T00205                                 

Gene name
pcm-1
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mca  Methylococcus capsulatus
Brite
Enzymes [BR:mca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MCA1211 (pcm-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1274479..1275138
Genome map
AA seq 219 aa AA seqDB search
MRDLEAEVSLTRHLTGRSALSPEVMEAMRKVPRHRFVPADRVQFAFDNGPVPIGCGQTIS
QPFIVALMTDLLNPEKESVVLEIGAGSGYQAAVLSRLVKRVYTVEIIPELGEQAAERLKE
LGYRNVEVRIGDGYFGWPEHAPYDGIIVTAAAPCFPDPLIGQLKPGGRMVIPVGPPYHHQ
ELMTVDKDAEGNIETCSVLPVAFVPLTGEGGYRPGPEQA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagggacctcgaggccgaggtttcgctgacgcgtcatctcaccggccgcagcgcgctg
tcgcccgaggtgatggaagccatgcgcaaggttccgcggcatcgcttcgtgccagccgac
cgggtgcagttcgctttcgacaacggtccggtccccatcggttgcggccagaccatctcc
cagcccttcatcgtggcgctgatgaccgatctgctgaatccggagaaggagtcggtcgtc
ctggaaatcggcgccggttccggctatcaggcggcggtcctgtcgcgcctggtgaagcgg
gtctacacggtcgaaatcatcccggaactgggcgagcaggcggccgagaggctgaaagag
ctcggctaccgcaacgtcgaagtccgcatcggcgacggctacttcggctggcccgaacac
gcgccctacgatggcatcatcgtcacggcggcggccccttgtttccccgatccattgatc
gggcaactcaagccgggggggcgcatggtgattccggtcggcccgccttaccaccatcag
gagttgatgacggtggacaaggacgccgagggtaacatcgagacctgcagcgtgctgccc
gtggctttcgtgccactgaccggcgaaggggggtaccggcccgggccggagcaggcatga

DBGET integrated database retrieval system