KEGG   Methylococcus capsulatus: MCA1222Help
Entry
MCA1222           CDS       T00205                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mca  Methylococcus capsulatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCA1222 (ruvA)
Enzymes [BR:mca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MCA1222 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1287306..1287911
Genome map
AA seq 201 aa AA seqDB search
MIGFIRGLLVAKRAPSLLIDVQGLGYELDAPMSTFYNLPEIGAEVRLYTHLQIREDAHSL
FGFGTEAERGLFRSLIRVSGIGAKLALAILSGISVDDFRACVERQDSARLVRLPGIGKKT
AERLIIELRDRLDIGVPSLAPASFAGGAAPLPAADPADEAVSALIALGFKPQEANTLVAR
QAAEGRSAEDLIRAALQSAVR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcttcatccgcggactcctggtggccaagcgtgcgccctccttgctgatcgac
gtgcagggtctgggctacgaactcgatgcgccgatgtccaccttttacaacttgcccgag
atcggcgctgaagtgcggctctacacccaccttcaaatccgcgaggacgcccatagcctg
ttcggcttcggcacggaagccgagcggggtctgttccgcagcctgatccgggtcagcggc
atcggcgccaagctggcgctggccatcctctccggcatctcggtcgacgatttccgcgcc
tgcgtggagcggcaggattcggcgcgtctggtgcggctccccggcatcggcaagaagacc
gcggagcgcctcatcatcgagctgcgggatcggctggatatcggcgtcccgtctctggct
ccggccagcttcgccggcggcgcagcgcccttgccggccgccgatcctgccgacgaggcc
gtgagtgccctgatcgcgctgggcttcaagccgcaggaggcgaatacgctggtggccagg
caggccgccgaagggcgcagcgcggaggatctgatccgggcggcgttgcagtcggcggta
cgctga

DBGET integrated database retrieval system