KEGG   Methylococcus capsulatus: MCA1222Help
Entry
MCA1222           CDS       T00205                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mca  Methylococcus capsulatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCA1222 (ruvA)
Enzymes [BR:mca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MCA1222 (ruvA)
DNA repair and recombination proteins [BR:mca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MCA1222 (ruvA)
    RecFOR pathway proteins
     MCA1222 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1287306..1287911
Genome map
AA seq 201 aa AA seqDB search
MIGFIRGLLVAKRAPSLLIDVQGLGYELDAPMSTFYNLPEIGAEVRLYTHLQIREDAHSL
FGFGTEAERGLFRSLIRVSGIGAKLALAILSGISVDDFRACVERQDSARLVRLPGIGKKT
AERLIIELRDRLDIGVPSLAPASFAGGAAPLPAADPADEAVSALIALGFKPQEANTLVAR
QAAEGRSAEDLIRAALQSAVR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcttcatccgcggactcctggtggccaagcgtgcgccctccttgctgatcgac
gtgcagggtctgggctacgaactcgatgcgccgatgtccaccttttacaacttgcccgag
atcggcgctgaagtgcggctctacacccaccttcaaatccgcgaggacgcccatagcctg
ttcggcttcggcacggaagccgagcggggtctgttccgcagcctgatccgggtcagcggc
atcggcgccaagctggcgctggccatcctctccggcatctcggtcgacgatttccgcgcc
tgcgtggagcggcaggattcggcgcgtctggtgcggctccccggcatcggcaagaagacc
gcggagcgcctcatcatcgagctgcgggatcggctggatatcggcgtcccgtctctggct
ccggccagcttcgccggcggcgcagcgcccttgccggccgccgatcctgccgacgaggcc
gtgagtgccctgatcgcgctgggcttcaagccgcaggaggcgaatacgctggtggccagg
caggccgccgaagggcgcagcgcggaggatctgatccgggcggcgttgcagtcggcggta
cgctga

DBGET integrated database retrieval system