KEGG   Methylococcus capsulatus: MCA1251Help
Entry
MCA1251           CDS       T00205                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mca  Methylococcus capsulatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:mca01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mca01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mca00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mca00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mca00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mca00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mca00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1330927..1332189
Genome map
AA seq 420 aa AA seqDB search
MAARNAFYAQSGGVTAVINASACGVLETARQYPDRIGTVYAGRNGIVGALTEDLIDTGQE
SAEAIAALRHTPSGAFGSCRYKLKGLEENRAQYERLIEVFRAHDIGYFFYNGGGDSADTC
LKVSQLSEKLGYPLQAVHIPKTVDNDLPITDCCPGFGSVAKYIAVSVREASFDVRSMAAT
STCIFVLEVMGRHAGWIAAAGGLASDERHELALVILFPEQVFDPERFLRAVDEKVRSHGY
CSVVVSEGIRGADGRFVAESGSRDVFGHARLGGVAPVIADLIKERLGYKYHWAVADYLQR
AARHIASRTDVEQAYAVGKAGVEMALKGLSAVMPAIVRTSDSPYRWEITAASLAEVANVE
KKMPLEFISADGFGITEACRRYLRPLIEGEDYPPYAGGLPDYVTLCNVAVPKKLAASFSV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggaatgctttctatgcccagtccggcggtgtgaccgccgttatcaatgca
tcggcctgcggcgtgctggagaccgcccggcagtatcccgaccgtatcggcacggtttac
gccgggcgtaacggcatcgtcggtgcactgaccgaggacctgatcgataccgggcaggag
agcgccgaagccatcgccgcattgcgccacactccctccggggcgttcggttcctgccgc
tacaagctcaaagggctggaggagaaccgggcccagtacgaacggttgatcgaggtcttc
cgcgcccacgacatcggctatttcttctacaacggcggcggggattccgccgatacctgt
ctgaaagtctcccagctttccgagaaattgggttatccgttgcaggccgtccatattccg
aagacggtggacaacgacctgccgatcaccgactgctgtccggggttcggttcggtcgcc
aagtacatagcggtatcggtacgcgaggcgagtttcgacgtacgctccatggctgcgact
tccacctgcatcttcgtgctggaagtcatgggccgccacgcgggctggatcgccgccgcc
ggcggtctggcgagtgacgagcggcatgagctggctctggtcatcttgtttcccgaacag
gtgttcgacccggaacggtttctccgggcggtggacgaaaaggtccggtcacatggctat
tgttcggtcgtggtgtcggagggcattaggggcgcggatggcaggttcgtcgccgaatcc
ggcagccgggacgtgttcgggcatgctcggctcggtggggtggcgccggtcatcgccgac
ctgatcaaggagcgcctgggttacaaataccactgggccgtcgccgattacctgcagcgc
gcggcccggcacatcgcctcccgcacggatgtcgagcaggcctatgcggtggggaaggcg
ggcgtcgagatggctctgaaagggctcagcgccgtgatgccggccatcgtgcgcacctcg
gattcgccttaccgttgggaaatcacggccgccagtctggcggaggtggccaacgtcgaa
aagaaaatgcccctcgaattcatcagcgccgacggtttcggcatcaccgaggcctgccgc
cggtacctccggcctctgatcgagggcgaggactaccctccctatgccggcggtttgccg
gattatgtgacattgtgcaatgtcgctgtcccgaaaaaactggccgcttcgttcagcgtc
tga

DBGET integrated database retrieval system