KEGG   Methylococcus capsulatus: MCA1251Help
Entry
MCA1251           CDS       T00205                                 

Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mca  Methylococcus capsulatus
Pathway
mca00010  Glycolysis / Gluconeogenesis
mca00030  Pentose phosphate pathway
mca00051  Fructose and mannose metabolism
mca00052  Galactose metabolism
mca00680  Methane metabolism
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
mca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCA1251
   00030 Pentose phosphate pathway
    MCA1251
   00051 Fructose and mannose metabolism
    MCA1251
   00052 Galactose metabolism
    MCA1251
  Energy metabolism
   00680 Methane metabolism
    MCA1251
Enzymes [BR:mca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCA1251
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MCA1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AAU92465
UniProt: Q609I3
Position
1330927..1332189
Genome map
AA seq 420 aa AA seqDB search
MAARNAFYAQSGGVTAVINASACGVLETARQYPDRIGTVYAGRNGIVGALTEDLIDTGQE
SAEAIAALRHTPSGAFGSCRYKLKGLEENRAQYERLIEVFRAHDIGYFFYNGGGDSADTC
LKVSQLSEKLGYPLQAVHIPKTVDNDLPITDCCPGFGSVAKYIAVSVREASFDVRSMAAT
STCIFVLEVMGRHAGWIAAAGGLASDERHELALVILFPEQVFDPERFLRAVDEKVRSHGY
CSVVVSEGIRGADGRFVAESGSRDVFGHARLGGVAPVIADLIKERLGYKYHWAVADYLQR
AARHIASRTDVEQAYAVGKAGVEMALKGLSAVMPAIVRTSDSPYRWEITAASLAEVANVE
KKMPLEFISADGFGITEACRRYLRPLIEGEDYPPYAGGLPDYVTLCNVAVPKKLAASFSV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcggaatgctttctatgcccagtccggcggtgtgaccgccgttatcaatgca
tcggcctgcggcgtgctggagaccgcccggcagtatcccgaccgtatcggcacggtttac
gccgggcgtaacggcatcgtcggtgcactgaccgaggacctgatcgataccgggcaggag
agcgccgaagccatcgccgcattgcgccacactccctccggggcgttcggttcctgccgc
tacaagctcaaagggctggaggagaaccgggcccagtacgaacggttgatcgaggtcttc
cgcgcccacgacatcggctatttcttctacaacggcggcggggattccgccgatacctgt
ctgaaagtctcccagctttccgagaaattgggttatccgttgcaggccgtccatattccg
aagacggtggacaacgacctgccgatcaccgactgctgtccggggttcggttcggtcgcc
aagtacatagcggtatcggtacgcgaggcgagtttcgacgtacgctccatggctgcgact
tccacctgcatcttcgtgctggaagtcatgggccgccacgcgggctggatcgccgccgcc
ggcggtctggcgagtgacgagcggcatgagctggctctggtcatcttgtttcccgaacag
gtgttcgacccggaacggtttctccgggcggtggacgaaaaggtccggtcacatggctat
tgttcggtcgtggtgtcggagggcattaggggcgcggatggcaggttcgtcgccgaatcc
ggcagccgggacgtgttcgggcatgctcggctcggtggggtggcgccggtcatcgccgac
ctgatcaaggagcgcctgggttacaaataccactgggccgtcgccgattacctgcagcgc
gcggcccggcacatcgcctcccgcacggatgtcgagcaggcctatgcggtggggaaggcg
ggcgtcgagatggctctgaaagggctcagcgccgtgatgccggccatcgtgcgcacctcg
gattcgccttaccgttgggaaatcacggccgccagtctggcggaggtggccaacgtcgaa
aagaaaatgcccctcgaattcatcagcgccgacggtttcggcatcaccgaggcctgccgc
cggtacctccggcctctgatcgagggcgaggactaccctccctatgccggcggtttgccg
gattatgtgacattgtgcaatgtcgctgtcccgaaaaaactggccgcttcgttcagcgtc
tga

DBGET integrated database retrieval system