KEGG   Methylococcus capsulatus: MCA1401Help
Entry
MCA1401           CDS       T00205                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mca  Methylococcus capsulatus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MCA1401
Enzymes [BR:mca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MCA1401
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MCA1401
Lipid biosynthesis proteins [BR:mca01004]
 Fatty acid synthase
  Component type
   MCA1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1488236..1488916
Genome map
AA seq 226 aa AA seqDB search
MSTCLAMIKARLPSGPASLLFLSIVSGFISITPLSADSAAADSLLVVGDSLSAGYGLSDS
GQGWVALLQQRLQPRNITVVNASIPGDTSGGGLARLPAALAAHRPRIVILELGANDGLRG
LPPAALKANLGAMIDQARSAGAQVLLLGMKLPPNYGGRYAEAFERVYQELAEEKQVRLLP
FFLDGVAGDEHLLQSDGLHPNAEAQPLLMKSVFEKLEPLLVSIDRP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacctgtctcgccatgatcaaagcgcgcctgccctccggtccggcatcgttgctg
ttcttgtccatcgtgtctggcttcatctcgataacccccctttcggcggattcagcggcg
gccgattctttgctcgtcgtgggcgacagcctcagtgccggctatggcctctcggacagc
ggccaagggtgggtcgcattgttgcagcaaagactgcagcctcgaaacatcaccgtggtc
aacgccagtattcccggcgataccagcggcggcggactggcccgcctgcctgcagcgctg
gcagcgcaccgtccccggatcgtgatccttgagctcggcgccaacgatggcctacgcggc
ctgcctccggcggcgttgaaagccaacctcggcgccatgatcgatcaggcgagatcggcc
ggggcgcaggtcctgcttctgggcatgaagcttccgccgaattacggcggccgctatgcg
gaggccttcgaacgggtgtatcaggaactcgccgaggagaaacaggttcgactcttgcca
ttttttctcgacggggtcgcaggggacgaacatctgctacagtctgatggcctccatcca
aacgccgaggcgcaacccctcctcatgaaaagcgtattcgagaaactcgaaccactccta
gtatcgatcgaccgaccatga

DBGET integrated database retrieval system