KEGG   Methylococcus capsulatus: MCA1473Help
Entry
MCA1473           CDS       T00205                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mca  Methylococcus capsulatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1563816..1565300)
Genome map
AA seq 494 aa AA seqDB search
MDAHGIFDRRRAGILLHISSLPGGPGNGDLGAESFRFVDFLAAAGVSVWQTLPINPTHED
GSPYQCTSVHAGNPLLIGLDWLIARGLLEADAIPPADDAKAIRQWALERAFDSFRRRGTS
DALCSAFGDFVSANDWWLADYALYAALKEVNGGLPWQAWPKPLRDRKPDALASASTLYAD
IIARVRFEQFVFFEQWQGLHDYAKKLGVLLFGDMPIFVASDSAEVWAGREYFELGEDGEP
RVVAGVPPDYFSATGQRWGNPHYNWESMERSGFSWWLNRLRTQLNLYDLIRIDHFRGFEA
YWEIPAHSETAMNGRWVKAPGEALLSRCTETFGESLPLVAEDLGIITAEVEALRRRFRIP
GMRILQFAFEGGPCNPYLPHNHAIDSVVYTGTHDNDTTLSWFEGLSAERQGYVYDYLGRS
GLPMPAALVQAAMASVARLAIVPMQDVLELGRGHRMNTPGTVGENWNWRFDWAQLRDEHA
ERLAHQVRMYGRTA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggatgctcacggaattttcgaccggcgccgcgcgggtattctgctccacatcagttcc
ctgcccggcggaccgggaaacggcgatctgggggccgaatccttccgtttcgtggatttc
ctcgctgcggcgggtgtttcggtatggcagacactgcccatcaatcccacccacgaggac
ggttcaccttatcagtgtacatccgtgcacgccggcaatccgctcttgatcgggttggac
tggttgattgcgcgcggactgctggaagccgatgccattcctcccgctgacgatgcgaaa
gcgatccggcagtgggctctggaacgtgctttcgattccttccgccggcgcggaacttcc
gatgctttgtgttccgcgttcggcgatttcgtcagcgcgaacgactggtggctggccgac
tacgccctctacgcggcactcaaggaggtcaacggtggcctgccctggcaggcctggccc
aagcccttgagggaccgcaaacccgatgccctggcatcggccagcacgttgtatgccgac
atcatagccagggtccgcttcgaacagttcgtattcttcgaacagtggcagggtttgcat
gactatgccaagaagctcggcgtgctgctgttcggtgacatgccaattttcgtcgcatcg
gacagcgcggaagtctgggcggggcgggaatatttcgaactgggcgaagacggagagccg
cgcgtcgtcgccggggtgcctccggactacttctccgccaccggccagcgctggggaaat
ccgcactacaattgggaaagcatggagcgctcgggtttctcctggtggctgaaccgcctg
cgcacccagctcaacctctacgacctgatccgcatcgaccatttccgggggttcgaagcc
tactgggaaattcccgcccattccgaaacggcgatgaatggacgctgggtcaaggctccc
ggcgaggccttattgtcgcgctgtaccgagaccttcggggagtccttgccgctggtcgcc
gaggaccttggcatcatcaccgccgaggtggaggcattgcggcgacgtttccgcatcccc
ggcatgcggatactccagttcgctttcgaaggcggtccctgcaatccgtacctgccccac
aatcatgccatcgacagcgtcgtttacaccggtacacacgacaacgacacgaccctgtcc
tggttcgaagggttgtcggcggagcggcagggatatgtctacgactacctcgggcgctcc
ggtctccccatgccggcggcgctggttcaggccgcgatggcatcagtcgcacggcttgcg
atcgttccgatgcaggacgtgctggagctggggcggggccaccgcatgaacacgccgggt
acggtgggcgaaaactggaactggcgtttcgactgggctcagttacgtgacgagcacgcc
gagcgtctggcccatcaggtccgcatgtacggccgtacggcctga

DBGET integrated database retrieval system