KEGG   Methylococcus capsulatus: MCA1549Help
Entry
MCA1549           CDS       T00205                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mca  Methylococcus capsulatus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCA1549
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCA1549
   00650 Butanoate metabolism
    MCA1549
  Energy metabolism
   00190 Oxidative phosphorylation
    MCA1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1651275..1651655
Genome map
AA seq 126 aa AA seqDB search
MKNYRTPLARARGLGSAREGLHDWWRQRVTAVALVPLGLWFAFSVALLPSASHAELVAWI
NVPWNTLLLLSFILIAFYHTMLGLQVVIEDYVHLDWLKLVGILGVKLVVSFLTLAAVYAI
LRIVFT
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactaccggactcccctcgctcgggcccgcggcctcggctccgcccgcgaagga
ctgcacgactggtggcggcagcgagtgacggcggttgcactggtcccgctgggactctgg
ttcgccttcagcgtagccttgcttccttccgccagccacgccgagctggtggcctggatc
aacgtcccctggaacactctgctgctcctttccttcatcctgatcgccttctaccacacg
atgctcggcttgcaggtcgtcatcgaggactatgtccatctcgactggctcaaactggtc
ggtatcctcggtgtcaaactggtggtctccttcctcacgctggcagctgtctacgccatc
ctccgcatcgtcttcacgtag

DBGET integrated database retrieval system