KEGG   Methylococcus capsulatus: MCA1587Help
Entry
MCA1587           CDS       T00205                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mca  Methylococcus capsulatus
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MCA1587
Enzymes [BR:mca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MCA1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1693459..1695894
Genome map
AA seq 811 aa AA seqDB search
MATQFPLSSEFERLTVYGPTRATVSGTPLDAEEVRKIHAFWRACNYLALGMIYLRGNPLL
REPLKPEHIKHRLLGHWGSSPNLAFVYTHLNRAIRKHDLDMIFMAGPGHGAPGVLGPLYL
EGSYSEIYPDKDLSEEGLLNFFKQFSFPGGIGSHCTPETPGSIHEGGELGYVLSHACGAA
FDNPDLIVAAVVGDGEAETGPLATSWHINKFLNPIRDGAVLPILNLNGYKINNPTLLARI
SHEELENLLRGYGYTPYFVEGSEPESMHQAMAATVDRSIEDIRAAQTEARASGIARRPRW
PMIVLRSPKGWTAPRQIDGHNVEGFWRAHQVPVADVAKNPEHLKLLEGWMRSYKPEELFD
AEGCPVAEIREMAPAGLRRMGLNPHANGGHLKKALRIPNFRNYGIEVAKPGQIEAPNTQP
LGVFLRDVMKENAHNFRLFGPDENTSNKLDAVYAAAKKFWIAEYFPEDQDGGELAPDGRV
MEMLSEHTLEGMLEGYLLTGRHGFLSTYEAFVHVIDSMFNQHAKWLSICNQLSWRQDVAS
LNLLITSTVWRQDHNGFTHQDPGFLDVVVNKSADVTRIYLPPDVNSLLSVADHCLRSQNY
INVIVSDKQLHLQFMDMDAAIAHCTEGLGIWEWASNDEGQEPDVVMACAGDIPTLEALAA
TALLREEFPELKIRFINVVDLFKLQPESEHPHGLSDKDFDSLFTRDKPVIFNFHGYPWLI
HRLAYRRTNHANMHVRGYKEKGNINTPLELAINNQIDRFSLAIDVIDRIPEIAVSGAHAK
ARFRKQQIACRQYAYEHGVDMPEVAGWRWPG
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccaattccccctgtcctccgaattcgaacggctcaccgtctacgggccgacc
cgcgccactgtcagcggaacaccgctggatgccgaagaagtccgcaaaatccatgcgttc
tggcgagcctgcaattacctggcgctgggcatgatctacctgcgggggaatccgctgctg
cgtgaaccgctcaaacccgagcacatcaagcaccgtctgctcggccattggggctccagc
cccaaccttgcgttcgtctacacccatctgaaccgggccatccggaaacacgacctcgac
atgatcttcatggccggccccggccacggcgcccccggcgtgctgggcccgctctacctg
gaaggcagctactccgaaatctaccccgacaaggacctgagcgaagaaggcctgctgaac
ttcttcaagcagttctccttccccggcggaatcggcagccattgcacccccgagacaccg
ggctcgatccacgagggcggcgagctgggctacgtgctgtcgcacgcctgcggcgcagcc
ttcgacaacccggacctgatcgtggccgccgtggtcggcgacggcgaggcggaaaccggc
cccctggccacttcctggcacatcaacaaatttctcaacccgatccgcgacggcgcggtg
ctgccgatcctcaacctcaacggctacaagatcaacaaccccaccctgctggcgcgcatc
agccacgaagaattggaaaatctgctcaggggttacggctacacgccttatttcgtggag
ggctcggaaccggaaagcatgcaccaggcgatggccgcgacggtggaccgcagcatcgaa
gacatccgcgccgcccagaccgaggcccgcgccagcggcatcgcccgacggccgcgctgg
ccgatgatcgtgctgcgctcgcccaagggctggaccgcgccacgccagatcgacggccac
aacgtcgagggcttctggcgcgctcatcaggtgccggtagccgacgtcgcgaaaaatccc
gaacacctgaagctgctggaaggctggatgcgcagctacaagccggaagaactgttcgac
gccgaaggctgccccgtcgccgaaatccgggaaatggcgccggccggtctccgccgcatg
ggtctcaacccccacgccaacggcggccatctgaaaaaggccctgcgcatccctaatttc
cgcaactacggcatcgaagtcgccaaaccgggccagatcgaagcgccgaacacccagccg
ctgggcgtgttcctgcgcgacgtgatgaaggagaacgcgcacaacttccggctgttcggc
cctgacgagaatacctccaacaagctggacgccgtctacgccgctgccaagaaattctgg
atcgccgagtatttccccgaagaccaggatggcggcgaactggcccccgacggccgggtc
atggaaatgctcagcgagcataccctggaaggcatgctggaaggctaccttctgaccggg
cgccacggcttcctctcgacctacgaagccttcgtccacgtcatcgattcgatgttcaac
cagcacgccaagtggctgtccatctgcaaccagctgtcctggcgccaggacgtggcctcg
ctcaacctgctcatcacttcgacggtctggcgacaggaccacaacggcttcacccaccag
gaccccggtttcctggacgtcgtcgtgaacaagagcgccgacgtcacccgcatctacctg
ccgcccgacgtcaacagcctgctgtcggtcgccgaccactgcctgcgcagccagaactac
atcaacgtgatcgtgtcggacaaacagttgcatctgcagttcatggacatggacgccgcg
atcgcccattgcacggagggcttgggcatctgggaatgggccagcaacgacgagggccag
gagcccgacgtggtcatggcctgcgccggcgacatcccgaccctggaagccctggccgcc
accgccctgctgcgcgaggagttcccggaactgaagatccgcttcatcaacgtggtggat
ctgttcaagctgcagcccgagtccgagcatccgcacggtctcagcgacaaggatttcgac
agcctgttcaccagggacaagccggtcatcttcaacttccacggctatccctggctgatc
caccgcctcgcctaccggcgcaccaaccacgccaacatgcacgtgcgcggctacaaggag
aaaggcaacatcaacaccccgctggaactggcgatcaacaaccagatcgaccgcttcagc
ctggccatcgacgtcatcgaccggattccggagatcgcggtctccggcgcccacgccaag
gcccggttccgcaaacagcagatcgcctgccgccagtatgcctacgagcacggcgtcgac
atgccggaggtcgcgggctggcgctggccgggctga

DBGET integrated database retrieval system