KEGG   Methylococcus capsulatus: MCA1717Help
Entry
MCA1717           CDS       T00205                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mca  Methylococcus capsulatus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MCA1717
Enzymes [BR:mca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MCA1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1833082..1834632)
Genome map
AA seq 516 aa AA seqDB search
MSDEESIKTRLKLRPVAIDTYRENVAYLHRECSVYRAEGFQALAKIRVGCNGKQIEAVLN
VVDDVCIVAPDELGLSEQAFQRFGEPAGQLVNVAQAEPPLSMDGVRRKIGGERLDYGDYQ
AITSDIAKGRYSKMEMAAFLVATGQNGLDRDEVLSLTRAMLETGVRLSWNEPLVADKHCI
GGIPGNRTSLLIVPIVAAHGMLIPKTSSRAITSPAGTADTMEVLARTDLAPESLDRLVRM
ERGCLAWGGTTRLAPVDDMLISVERPLGIDSQGQMVASILSKKLAAGATHLLLDIPVGPT
AKVRQMRDAMSLRKLFEYVGDRVGLHLEAVITDGAQPVGRGIGPVLEVRDVMQVLENDPE
APVDLREKSLRLAGRILEFDPDVRGGFGYSIARDILESGRALAKMHRIIDAQGRQERRLE
PGRLVFEVRAERAGVVVGIDNFFLAQTARLAGAPMSRGAGVDLLNKLGDTVEEGQPLYRV
YAEFPANFEFAREFTRTRSGYNIGDAAFLTKTHMEF
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaagagtcgatcaagactcgcctgaagctccggccggtggcgatcgatacg
taccgggaaaacgtggcgtacctgcaccgcgaatgttcggtgtatcgggcggagggcttt
caggcgctcgccaagatccgggtgggctgcaacggcaagcagatcgaggcggtgctgaac
gtggtggacgatgtctgcatcgtggccccggacgagctgggcctgtcggagcaggcattc
cagcgtttcggcgaacccgcgggccagctcgtgaacgtggcgcaggccgagcctccacta
tccatggacggcgtccggcgcaagatcggcggggaacggctggattacggcgattatcag
gccattaccagcgacattgccaaagggcgctattccaagatggagatggccgcgttcctg
gtggcgaccggccagaacgggttggatcgtgacgaagtgctgtcgctgacgcgtgcgatg
ctggaaaccggggtgagattgagctggaatgagccgctggtggccgataaacactgcatc
ggtggcattccgggcaaccggacgtcgttgttgatcgtgcccatcgtggcggcgcacggg
atgctgatccccaagacctccagccgcgccatcacttcgcctgccgggacggcggacacc
atggaagtgctcgcgcgcaccgatctggcgccggaatcactcgaccggctggtgcggatg
gaacggggttgtctggcgtggggtggcaccactcgcctggctccggtcgacgatatgctc
atctcggtcgaacgtcccctcggcatcgattctcaaggccagatggtcgcttctattctg
tcgaagaagttggcggccggcgccacccatctgctgttggacattccggtcggccctacc
gccaaggtgcggcagatgcgcgatgccatgagtctcaggaaactgttcgaatacgtcggt
gaccgcgtcggcctgcatctggaagccgtgatcaccgacggtgcccagccggtcggccgc
ggcatcggtccggtgctggaggtgcgggacgtcatgcaggtgctggagaacgatccggaa
gcgccggtcgatctgcgcgaaaaatccttgcgcctggccggtcgcatcctcgagttcgat
cccgacgtccggggcggcttcggctattcgatcgctcgagacatcctggaatcgggccgg
gcgctcgccaagatgcaccggatcatcgatgcccagggccggcaggagcggcgcctggag
cccggcaggctggtcttcgaggtgcgggcggagcgggccggcgtggtggtcgggatcgac
aattttttcttggcgcagacggcccgcctcgccggcgcaccgatgagccgaggggcaggc
gtggatctgttgaacaagctgggcgatacggtagaggaggggcagccgctctaccgggtc
tacgcggaattccctgccaatttcgaattcgcccgggagttcacgcgcacgagaagcggt
tacaacatcggagatgccgctttcctgaccaagactcacatggagttctga

DBGET integrated database retrieval system