KEGG   Methylococcus capsulatus: MCA1924Help
Entry
MCA1924           CDS       T00205                                 

Definition
(GenBank) ABC transporter, permease family protein
  KO
K02026  multiple sugar transport system permease protein
Organism
mca  Methylococcus capsulatus
Module
mca_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:mca02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    MCA1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AAU92095
UniProt: Q606U1
Position
complement(2070513..2071328)
Genome map
AA seq 271 aa AA seqDB search
MRYPALIFYLVLSLATAATLFPLVWMVSVSLMPPAEAMRYPPPLWPEAPTLEHYRTLFDR
LAIARYALNSLVLAGAVTAPSVLVNAAAGYAFARLPFVGRDALFRLLMTFMVIPGQVAML
PLFLLLKQLGLINTYAGVIVPGLASIFGIFLVRQYALSLPQSLFDAARLEGAGELRIFWS
LVLPLCRPILITLAVFTFLGSWNDFLWPLIVLTDRRLQTLPVALAALMGEHAVDTELMMS
GAALTVVPVIVLFLAAQRYYLGGLMQGGVKG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatccggctctgattttctacctcgttctgtcgctggcgacggcggcgaccctg
tttccgctggtctggatggtttcggtgtcgttgatgccaccggccgaagccatgcgctat
ccgcccccgctctggcccgaggccccgacgctggagcattaccggacattgttcgatcgc
ctggcgattgcgcggtatgcgttgaacagcctggtgctggccggtgctgtcacggctccg
tcggtgctggtcaacgcagccgccggctacgccttcgcccgcctgccgttcgtggggcgg
gatgcgctattccggttgttgatgaccttcatggtcatcccggggcaggtcgccatgctg
cccctgttcctgctgctgaagcagctcggcctgatcaacacctatgccggtgtgatcgtt
cccgggttggccagcattttcgggatattcctggtgcggcagtatgcgctgtcactgcca
caaagcctgttcgatgcggcgaggctggagggggccggtgagctgcgcatcttctggtcg
ctggtgctgcccctgtgccggccgattttgattacgctggcggtcttcaccttcctcggg
agctggaacgatttcctctggcccctgatcgttctgaccgaccgtcgtcttcaaaccctc
ccggtggcgctggctgccctgatgggggagcatgcggtggacaccgagctgatgatgtcg
ggtgcagccctcacggtggtgccggtgatcgttctgttcctggcagcgcagcgatactac
ctcggcgggctgatgcagggcggcgtcaagggatag

DBGET integrated database retrieval system