KEGG   Methylococcus capsulatus: MCA1924Help
Entry
MCA1924           CDS       T00205                                 

Definition
sugar ABC transporter permease
Orthology
K02026  
multiple sugar transport system permease protein
Organism
mca  Methylococcus capsulatus
Module
Putative multiple sugar transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2070513..2071328)
Genome map
AA seq 271 aa AA seqDB search
MRYPALIFYLVLSLATAATLFPLVWMVSVSLMPPAEAMRYPPPLWPEAPTLEHYRTLFDR
LAIARYALNSLVLAGAVTAPSVLVNAAAGYAFARLPFVGRDALFRLLMTFMVIPGQVAML
PLFLLLKQLGLINTYAGVIVPGLASIFGIFLVRQYALSLPQSLFDAARLEGAGELRIFWS
LVLPLCRPILITLAVFTFLGSWNDFLWPLIVLTDRRLQTLPVALAALMGEHAVDTELMMS
GAALTVVPVIVLFLAAQRYYLGGLMQGGVKG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatccggctctgattttctacctcgttctgtcgctggcgacggcggcgaccctg
tttccgctggtctggatggtttcggtgtcgttgatgccaccggccgaagccatgcgctat
ccgcccccgctctggcccgaggccccgacgctggagcattaccggacattgttcgatcgc
ctggcgattgcgcggtatgcgttgaacagcctggtgctggccggtgctgtcacggctccg
tcggtgctggtcaacgcagccgccggctacgccttcgcccgcctgccgttcgtggggcgg
gatgcgctattccggttgttgatgaccttcatggtcatcccggggcaggtcgccatgctg
cccctgttcctgctgctgaagcagctcggcctgatcaacacctatgccggtgtgatcgtt
cccgggttggccagcattttcgggatattcctggtgcggcagtatgcgctgtcactgcca
caaagcctgttcgatgcggcgaggctggagggggccggtgagctgcgcatcttctggtcg
ctggtgctgcccctgtgccggccgattttgattacgctggcggtcttcaccttcctcggg
agctggaacgatttcctctggcccctgatcgttctgaccgaccgtcgtcttcaaaccctc
ccggtggcgctggctgccctgatgggggagcatgcggtggacaccgagctgatgatgtcg
ggtgcagccctcacggtggtgccggtgatcgttctgttcctggcagcgcagcgatactac
ctcggcgggctgatgcagggcggcgtcaagggatag

DBGET integrated database retrieval system