KEGG   Methylococcus capsulatus: MCA1953Help
Entry
MCA1953           CDS       T00205                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mca  Methylococcus capsulatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCA1953 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCA1953 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MCA1953 (sucB)
Enzymes [BR:mca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCA1953 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2103375..2104520
Genome map
AA seq 381 aa AA seqDB search
MRIEISVPPLPESVSDAKLLDWHKNVGETVGKGENLVDLETDKVVLEVPAPEDGVVVEVR
GGKGDVVVSGQPIAVIDTSVRPAAPAASAATEKPAPVLSPAVRRLVAEHALDPAVIPASG
REGRLTKQDVLDFLETRPAAEKARLPAGGRSERRVPMSRLRARIAERMLEAQHRTATLTT
FNEVNLQKVFDIRNAHKARFEQQHGIKLGFMSFFVKASVEALRRFPIVNASLEGEEIVYH
DYYDIGIAVSTDRGLVVPILRDADRTDFAGIEKAIAEFGQKARSGKLSLDELSGGTFTIT
NGGIFGSMLSTPILNPPQSAILGMHAIKERPVVEDGQIVIRPMIYLALSYDHRLIDGRDA
VSFLFTIKELLEDPVRLMLAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgaaatcagtgtgcctcctctgcctgagtccgtcagcgacgccaagttgctg
gactggcacaagaacgtcggcgagaccgtgggcaagggcgaaaacctggtcgacctcgaa
accgacaaggtggtgttggaagttccggctccggaggacggggtggtggtggaggtgcgg
ggcggcaagggcgatgtcgtggtcagcggacagccgatcgccgtgatcgacacgtcggtt
cggcccgccgcgcccgccgccagcgcggcgacggagaaaccggcgccggtgctgagcccg
gcggtacgccgcctggtcgctgaacatgccctcgatccggcggtgattccggccagtgga
cgcgaaggacggctgaccaaacaggacgtgctggacttcctggaaaccagacccgctgcg
gagaaggcacgcctgccagccggagggcgaagcgaacgccgggtaccgatgagccgactg
cgcgccaggatcgccgagcgcatgctggaagcccagcatcggaccgccaccctgaccacc
ttcaacgaggtcaatctgcagaaggtgttcgacatccgcaacgcacacaaggcccgcttc
gagcagcagcacggcatcaagctcggcttcatgtcgttcttcgtcaaggcctcggtggaa
gcgctgcgccgatttcccatcgttaacgcttccctcgaaggcgaggaaatcgtctaccac
gactattacgacatcggcattgccgtttccacggaccgcgggctggtcgtaccgatcctg
cgcgatgccgaccggaccgatttcgccgggatcgagaaagcgatcgcagaattcgggcag
aaagcgcgcagtggcaagctgagcctggacgaactcagcggcgggaccttcaccatcacc
aacggcggcatattcggctccatgctgtcgactccgatcctcaatccgccgcagagcgcc
atcctcggcatgcatgccatcaaggaacggccggtggtggaagacggccagatcgtgatc
cggcccatgatctatctggcactgtcctacgaccaccgactcatcgacggccgtgatgcc
gtctcgttcctctttaccatcaaggaactgctcgaagatcccgtccgcctcatgctcgcg
gtgtga

DBGET integrated database retrieval system