KEGG   Methylococcus capsulatus: MCA1953Help
Entry
MCA1953           CDS       T00205                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mca  Methylococcus capsulatus
Pathway
mca00020  Citrate cycle (TCA cycle)
mca00310  Lysine degradation
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
mca01130  Biosynthesis of antibiotics
mca01200  Carbon metabolism
Module
mca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCA1953 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MCA1953 (sucB)
Enzymes [BR:mca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCA1953 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AAU92043
UniProt: Q606R2
Position
2103375..2104520
Genome map
AA seq 381 aa AA seqDB search
MRIEISVPPLPESVSDAKLLDWHKNVGETVGKGENLVDLETDKVVLEVPAPEDGVVVEVR
GGKGDVVVSGQPIAVIDTSVRPAAPAASAATEKPAPVLSPAVRRLVAEHALDPAVIPASG
REGRLTKQDVLDFLETRPAAEKARLPAGGRSERRVPMSRLRARIAERMLEAQHRTATLTT
FNEVNLQKVFDIRNAHKARFEQQHGIKLGFMSFFVKASVEALRRFPIVNASLEGEEIVYH
DYYDIGIAVSTDRGLVVPILRDADRTDFAGIEKAIAEFGQKARSGKLSLDELSGGTFTIT
NGGIFGSMLSTPILNPPQSAILGMHAIKERPVVEDGQIVIRPMIYLALSYDHRLIDGRDA
VSFLFTIKELLEDPVRLMLAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgaaatcagtgtgcctcctctgcctgagtccgtcagcgacgccaagttgctg
gactggcacaagaacgtcggcgagaccgtgggcaagggcgaaaacctggtcgacctcgaa
accgacaaggtggtgttggaagttccggctccggaggacggggtggtggtggaggtgcgg
ggcggcaagggcgatgtcgtggtcagcggacagccgatcgccgtgatcgacacgtcggtt
cggcccgccgcgcccgccgccagcgcggcgacggagaaaccggcgccggtgctgagcccg
gcggtacgccgcctggtcgctgaacatgccctcgatccggcggtgattccggccagtgga
cgcgaaggacggctgaccaaacaggacgtgctggacttcctggaaaccagacccgctgcg
gagaaggcacgcctgccagccggagggcgaagcgaacgccgggtaccgatgagccgactg
cgcgccaggatcgccgagcgcatgctggaagcccagcatcggaccgccaccctgaccacc
ttcaacgaggtcaatctgcagaaggtgttcgacatccgcaacgcacacaaggcccgcttc
gagcagcagcacggcatcaagctcggcttcatgtcgttcttcgtcaaggcctcggtggaa
gcgctgcgccgatttcccatcgttaacgcttccctcgaaggcgaggaaatcgtctaccac
gactattacgacatcggcattgccgtttccacggaccgcgggctggtcgtaccgatcctg
cgcgatgccgaccggaccgatttcgccgggatcgagaaagcgatcgcagaattcgggcag
aaagcgcgcagtggcaagctgagcctggacgaactcagcggcgggaccttcaccatcacc
aacggcggcatattcggctccatgctgtcgactccgatcctcaatccgccgcagagcgcc
atcctcggcatgcatgccatcaaggaacggccggtggtggaagacggccagatcgtgatc
cggcccatgatctatctggcactgtcctacgaccaccgactcatcgacggccgtgatgcc
gtctcgttcctctttaccatcaaggaactgctcgaagatcccgtccgcctcatgctcgcg
gtgtga

DBGET integrated database retrieval system