KEGG   Methylococcus capsulatus: MCA1963Help
Entry
MCA1963           CDS       T00205                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mca  Methylococcus capsulatus
Pathway
mca00340  Histidine metabolism
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MCA1963 (hisD)
Enzymes [BR:mca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MCA1963 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AAU92021
UniProt: Q606Q2
Structure
PDB: 

Jmol
Position
complement(2115248..2116558)
Genome map
AA seq 436 aa AA seqDB search
MTEVKIKRLYTGDADFASQLDRLLAWSESEDTDIHQRVTEIIGCIRRDGDAALVELTARF
DHFVVDTAAALELPRDVLEAAWQALPAEQAKALREAAERIRAYAERQKLDSWDYREADGT
LLGQKITPLDRVGLYVPGGKAAYPSSVLMNAVPAKVAGVPELIMAVPAPRGELNALVLAA
AYISGVDRVFRIGGAQAVAALAYGTETVPRVDKIVGPGNIYVATAKKLVFGQVGIDMVAG
PSEILVISDGRTDPDWIAMDLFSQAEHDEDAQAILISPDAAHLEAVQASIERLLPGMERA
EVIRTSLERRGGMILVDDLEQAAAVANRIAPEHLELSVESPEVLVESIRNAGAIFMGRYT
AEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIYCSPDGADQLGRTASLLAWGE
GLGAHARSAEYRIRHH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtaaaaatcaaacggctttacaccggcgatgcggactttgcatcgcaactg
gacaggctgcttgcctggagcgaaagcgaggacaccgacatccaccagcgcgtgaccgag
atcatcggctgcatccgccgcgatggcgatgcggccctggtggagctcacggcccgtttc
gaccatttcgtcgtggataccgctgcggcgctcgagctgccgcgtgacgtgctggaagcg
gcctggcaggcgctgcccgccgaacaagccaaagccctgcgggaagcggcggagcgcatc
cgggcctacgccgagcggcaaaagctcgattcctgggactaccgtgaagccgacggcact
ttgctgggacagaagatcacgccgctcgaccgggtcggcctgtatgtacccggtggcaag
gccgcatatccttcctcggtactgatgaatgcggttcctgccaaggtggcgggcgtgccg
gaactcatcatggcggtgccggctccgcggggagagctgaacgccctggtgctggctgcc
gcctatatttccggagtggaccgggttttccgcatcggtggcgcacaggccgtcgccgcc
ctggcttatgggacggaaacggtgccgcgggtcgacaagatcgtcggccccggtaacatc
tatgtggcgaccgccaaaaagctggtgttcggccaagtcgggatcgacatggtcgcaggc
ccctcggagatcctggtgatctcggacggacggaccgacccggactggatcgccatggat
ctgttttcgcaagccgagcatgacgaggacgcccaggcgatcctgatcagcccggatgca
gcccatctggaggcggtacaggcaagcatcgagcggctgttgcccggcatggagcgcgcc
gaggtcatccgcacctcgctggagcggcgcggcggcatgatcctggtcgatgatctggag
caggcggcggcggtcgccaatcgcatcgcgccggaacatctggagctttcggtggagagc
ccggaggtcctggtggagtcgatccgcaatgccggggccatcttcatggggcgctatacc
gcggaagcgctcggcgattactgtgccggtcccaaccacgtcctgccgacttcgggcacg
gcgcgcttctcgtcgccgctgggcgtctatgatttccagaagcgttccagcctgatctac
tgttcgccagacggcgcagaccaactgggccgtaccgcttcgctgctggcctggggcgaa
gggctgggggcgcatgcccgttcggccgaatatcggatcaggcaccattaa

DBGET integrated database retrieval system