KEGG   Methylococcus capsulatus: MCA1984Help
Entry
MCA1984           CDS       T00205                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mca  Methylococcus capsulatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MCA1984
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MCA1984
Enzymes [BR:mca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MCA1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2135733..2136737
Genome map
AA seq 334 aa AA seqDB search
MFDLVGPRLSADEREFLCHPAAGGLILFSRNYASPDQMLALVSEVRSLRPDMLIAVDHEG
GRVQRFREGFTRLPPASAYLEVAGEAGLAAAETAGWLMAAELRAVGVDFSFAPVLDVDSG
ISTVIGDRAFARTPEEVTAAARAFATGMRRAGMAAVGKHFPGHGGVAGDSHLVLPEDRRE
LEELLARDLLPFSALIRENLEGIMPAHVLYSRIDARPPCFSPFWLQTILRERMNFDGAIF
SDDLSMAGAAVAGDYAARALAALEAGCDMLVVCNTPEATASILEALENRTASPGSTRRLA
AMCGRSRIDRDALLASSEWRNAVDRIHSFNDSAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacctcgtcgggccccggctgtccgcagacgaacgtgaattcctgtgtcacccc
gccgccggcgggctgatcctgttcagccggaactacgcgtcaccggaccagatgctggcg
ctggtatcggaagtccgcagcttgcggcccgacatgctgatcgccgtggatcatgagggc
ggtcgggtccagcgtttccgcgaaggcttcacccggctgccgccggcctccgcgtacctc
gaagtggctggcgaagccggactggcggcggccgaaacggcaggctggctgatggcagcg
gagctgcgcgccgtgggcgtggacttcagcttcgcgccggtgctcgacgtcgacagcggc
atcagcaccgtcatcggcgaccgcgccttcgcccgtacacccgaggaagtcaccgccgcg
gcccgcgccttcgccaccggcatgcggcgtgcgggcatggcggcggtgggcaaacacttc
cccggccacggtggtgtggccggcgactcgcacctcgtgctgcccgaagaccgacgcgaa
ctcgaagaattgctcgcgcgtgatctgctgcccttctcggcgttgatccgtgagaacctc
gaaggcatcatgccggcccacgtcctctactcccgtatcgacgcccggccgccgtgcttc
tcccctttctggctgcagaccatcctgcgcgaacggatgaatttcgatggcgcgatcttc
tcggacgacctgtccatggccggcgcggccgtggccggcgactatgccgcgcgtgcgctg
gcggcactcgaggcaggctgcgacatgctggtggtctgcaacacccccgaggcgacggcg
agcattctggaagccctggaaaaccgtaccgcatcccccggcagtacccgccgtctcgcc
gccatgtgcggccgctcgcgaatcgaccgcgacgcgctgctggcaagtagcgaatggcgt
aatgcggtcgaccgcattcactctttcaacgactctgcgcaatga

DBGET integrated database retrieval system