KEGG   Methylococcus capsulatus: MCA2043Help
Entry
MCA2043           CDS       T00205                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mca  Methylococcus capsulatus
Pathway
mca00010  Glycolysis / Gluconeogenesis
mca00620  Pyruvate metabolism
mca00640  Propanoate metabolism
mca00680  Methane metabolism
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
mca01130  Biosynthesis of antibiotics
mca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCA2043 (acs)
   00620 Pyruvate metabolism
    MCA2043 (acs)
   00640 Propanoate metabolism
    MCA2043 (acs)
  Energy metabolism
   00680 Methane metabolism
    MCA2043 (acs)
Enzymes [BR:mca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MCA2043 (acs)
Lipid biosynthesis proteins [BR:mca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MCA2043 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAU91699
UniProt: Q606H4
Position
2196052..2198040
Genome map
AA seq 662 aa AA seqDB search
MLPEYNSRSAADRTSDNRMKTEHVYPVPSDIATSARITDEIYREMYDRSIRDPEGFWAEL
AQEFISWNTPWQRVARWNFHTPSIEWFSGARLNVSYNCLDRHLADRRDQTAILWEGDEPG
DQRALTYGELHDRVCRFANVLKSHGVGKGDRVCIYLPMIPEAAVAMLACARIGAIHSIVF
GGFSSEALKDRILDADCRVLICADEGRRGGKFVPLKRNVDAALSQCPHVETVLVVRHTGR
PVDWTAGRDHWFHEAVQSASADCPPEDMDAEDPLFILYTSGSTGKPKGVVHTTGGYLLFA
AVTHKYVFDYRDGEVYWCTADIGWITGHSYVVFGPLCNGATTLMFEGVPTYPTPARLWQI
IDKYQVSIFYTAPTVIRALMGLGADWVKQADRHSLRILGSVGEPINPEAWEWYYQEVGEK
RCPVLDTWWQTETGGIMITPLPGATPLKPGSATRPFFGVVPVILDPQGNELTGPAEGVLA
IAASWPGQARTVFRNHDRFRETYFALYPGKYFTGDGARRDADGYYWITGRVDDVINVSGH
RMGTAEIESALVLHDSVAEAAVVGYPHNIKGQGIYAYVTLVADAVPSEDLKRQLIELVRE
EIGAIATPDIIQWTPALPKTRSGKIMRRILRKIAANELDQLGDTSTLADPAVVEDIIRNK
PA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcctgagtataattcccggtccgcagccgaccggacgagcgacaatcgaatgaaa
acagaacatgtctaccccgtgccctccgatattgcgacgtccgccagaataaccgacgaa
atctatcgggaaatgtatgaccggtccatcagggacccggaaggattctgggccgagctg
gctcaggagttcatcagctggaacaccccctggcagcgggtggcgcgctggaatttccat
accccatccatcgaatggttctccggtgcccgccttaacgtgtcttacaattgtctggac
cgccatctggctgaccggcgcgatcaaacggccattctgtgggagggcgacgagcccggc
gaccagcgcgccctgacctacggcgagctgcacgaccgggtctgccggtttgccaatgtg
ctcaaatcccatggcgtaggcaagggtgaccgggtgtgcatctatttgccgatgatcccg
gaagccgccgtagccatgctggcctgtgcccgtataggcgccatccactcgatcgtgttc
ggcgggttctcgtccgaggcattgaaagaccggattctggatgccgattgccgcgtcctg
atctgcgccgacgaaggccgacggggcggcaaattcgtcccgctcaaacgtaacgtcgac
gccgcgctgagccagtgtccgcatgtcgaaaccgtgctggtggtccgccatacgggccgt
ccggtggactggaccgcggggcgcgaccactggtttcacgaggccgtgcaatccgcatcg
gccgactgcccccccgaggacatggatgcggaagacccgctgttcatcctctacacttcc
ggctcgaccggcaagccgaaaggggtggtccatacgaccggcggctacctgctgtttgcc
gccgttacgcacaaatacgtgttcgattaccgcgacggcgaagtgtactggtgcaccgcg
gacatcggctggatcaccggccacagctacgtggtcttcggccccttgtgcaacggggcg
accacactgatgttcgagggcgtgccgacctaccccacaccggcacggctatggcagatc
atcgacaaatatcaggtcagcattttctacacggcgccgacggtcatccgggcactgatg
ggactgggcgcggactgggtgaagcaggccgaccgccacagcctgcgaatactgggctcg
gtcggcgaacccatcaatccggaagcctgggaatggtattaccaggaagtcggcgagaaa
cgctgccccgtgctcgacacctggtggcagaccgaaaccggcggcatcatgatcacccca
ctgcccggcgccacaccgctcaaacccggctccgccacccgccccttcttcggcgtcgtc
cccgtcatcctggatccccagggcaacgagctgacgggcccggcagagggcgtcctggcg
atcgccgcatcctggccaggccaggcgcgtaccgtattccgcaatcacgatcgtttccgt
gaaacgtatttcgccctctatccggggaagtacttcactggcgatggcgcgcgccgggat
gccgacggttattactggatcaccggacgggtggacgacgtgatcaacgtctcggggcac
cgcatgggaaccgccgaaatcgagagcgccctggtactgcacgacagcgtcgccgaagcc
gcggtggtcggttacccgcacaacatcaagggccagggcatctacgcctatgtcaccctg
gtcgccgacgcggtcccgagcgaggacctgaaacggcaactgatcgaactggtccgggag
gaaatcggcgcgatcgcgacccctgacatcatccagtggacgccggccctgccgaagacg
agatcgggtaaaatcatgcggcgcatcctgcgaaagatcgccgccaacgagctggatcaa
ctgggagatacgtcgacactggccgacccggcggtcgtcgaagacatcatccggaacaaa
ccagcctag

DBGET integrated database retrieval system