KEGG   Methylococcus capsulatus: MCA2098Help
Entry
MCA2098           CDS       T00205                                 

Definition
(GenBank) putative DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mca  Methylococcus capsulatus
Pathway
mca00230  Purine metabolism
mca00240  Pyrimidine metabolism
mca01100  Metabolic pathways
mca03030  DNA replication
mca03430  Mismatch repair
mca03440  Homologous recombination
Module
mca_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MCA2098
   00240 Pyrimidine metabolism
    MCA2098
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MCA2098
   03430 Mismatch repair
    MCA2098
   03440 Homologous recombination
    MCA2098
Enzymes [BR:mca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MCA2098
DNA replication proteins [BR:mca03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MCA2098
DNA repair and recombination proteins [BR:mca03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     MCA2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AAU91902
UniProt: Q606C0
Position
complement(2257273..2257731)
Genome map
AA seq 152 aa AA seqDB search
MTRVDFYLLPAGESLLSYACRLTEKAYRQGHTVFLVTDTDDEAAQLDDMLWTFRQGSFVP
HRAVTGHTAAGPCPVAVGREPPVGFDDVMINLGSAVPEAFRRFRRVIELVGPDDAARALK
REHFRHYRSEGLNPAMVDLEAEACPSRRVGYH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggtcgatttctatctgctgccggccggtgaaagcctgttgtcctacgcctgc
cggctgaccgagaaggcctaccgccaaggacacacggtgttcctggtgacggataccgat
gacgaggcggcgcaactggacgacatgctgtggactttccggcagggcagtttcgtccca
caccgtgcagtgaccggtcacacggctgccggtccttgtccggtggcggtgggccgggaa
ccgcccgtcgggttcgacgatgtgatgatcaatctgggttctgccgtgcccgaggcattc
cgccgcttccggcgcgtgatcgagctggtcgggccggacgatgccgcgcgggcgctcaag
cgcgagcatttccgccattaccggagcgaggggctgaaccccgccatggtcgacctcgaa
gccgaggcgtgcccctcccggcgggttggatatcattaa

DBGET integrated database retrieval system