KEGG   Methylococcus capsulatus: MCA2127Help
Entry
MCA2127           CDS       T00205                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mca  Methylococcus capsulatus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MCA2127
Enzymes [BR:mca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MCA2127
Peptidases [BR:mca01002]
 Cysteine Peptidases
  Family C44
   MCA2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2288140..2289957)
Genome map
AA seq 605 aa AA seqDB search
MCGIAGLVLKGRNVQADRLHPMIERLAHRGPDGQGVFTEGGFGLAHTRLSIIDLSGGRQP
ILADDGRLAVVANGEIYNHVELREALEREGRRFATHSDSETILHAYALDPEGFAGRLHGM
FAFALYDGVRRRLVLGRDRLGIKPLFYAALPDRLVFASEMKAILPLLPNAPTIDAGAFSQ
FLHTHCSTGEETLFSGIRRLGPGEILEADAELNLRKRRYWTPLGVRSRALDFAEAEAEFE
GMFEQVMKEHVRSDVPYGLFLSGGNDSAILLAMLSRLQAQPVRTFSIGYVDAAMKDELGD
AERIAQVFGSRHTSIRLRREDLFRRIPHTVWAADDLMRDYASFPTSALSEAAAKELKVVF
TGEGGDEVFGGYRRYRQPRLAWLARNLLAPGTGGFRTRSEWWRKRSQRLFGPALAAERKH
FRAPYLKAWSEAPAVWSHLQHCQYTDLVTDLPDSLLVKVDRMMMGFGLEGRVPFLDHRVV
EFGLGLPDALKTDGKRPKVFLRRWAERHVPKEHLYTKKRGFTVPVREWLGGELLDRLEGK
LSGNAAVREWFDTRHFPALFQAQRKKGNASREIFCLMQFAIWHRLFIDQPGLKPSPDEDP
LDWIS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatagcggggctcgtcctgaaaggacggaatgtccaggcagacaggctccac
cccatgatcgagcgcctggcccatcgggggccggacggtcagggggtattcaccgaaggc
ggattcggcctggcccacacccgcctgtcgatcatcgatctcagcggcggccgccagccc
attctggccgacgacggccggctcgccgtcgtcgccaacggcgagatctacaaccacgtc
gagctccgcgaggcgctggagcgggaggggcgccgtttcgccacgcattccgacagcgaa
accatcctgcatgcttacgcgctcgatccggaaggattcgccgggcgtctccacggcatg
ttcgcattcgcgctgtacgacggcgtccgccggcggctggtgctgggacgcgaccgtttg
gggatcaagcccttgttctacgccgcgctgcccgaccggctggtgttcgcgtccgagatg
aaggcgatcctgccgctgctgccgaacgcgcccactatcgacgccggcgccttttcccag
ttcctccacacgcactgctcgaccggcgaggagaccctgttttccggcatccggcgcctc
gggccgggcgagatcctcgaggcagacgccgagctgaacctccgcaagcggcggtactgg
acgccgctcggcgtgaggtcgcgggcgctggacttcgcggaggccgaggccgaattcgag
gggatgttcgagcaggtgatgaaggagcacgtccgctccgacgtgccctatggcctgttt
ctgtccgggggcaacgattcggcgatcctgctggccatgctcagccgcttgcaggcgcag
ccggtccggaccttttccatcggttacgtcgatgcggcgatgaaggacgagctgggcgat
gccgagcggatcgcgcaggtgttcggcagccggcacacgtcgatccgcctgcgccgcgag
gatctgttccggcggattccccacacggtctgggccgccgacgacctgatgcgggattac
gcgagctttccgacttcggcgctgtccgaggcggcggcgaaggaactcaaggtggtgttc
accggcgaaggcggcgacgaggtcttcggcggctaccggcgctaccgtcagccgcgactg
gcgtggctggccagaaatctcctggcaccggggacgggcggtttccgcacccgcagcgaa
tggtggcggaagcgctcacagcgtctgttcgggccggcgctggcggccgagcggaagcat
ttccgtgctccgtacctcaaggcctggagcgaggcgcccgcggtatggagccatctgcag
cactgccagtataccgatctggtcaccgacctgccggacagtctgctggtcaaggtggac
cggatgatgatgggtttcggcctggaagggcgggtgcccttcctcgaccaccgggtcgtc
gaattcggcctgggcttgcccgatgcgctcaagaccgatggcaaacggcccaaggtgttc
ctgcgccgctgggccgagcgccatgtgccgaaggagcatctctacaccaagaagcgcggc
ttcaccgtgccggtgcgggaatggctgggcggcgagctgttggaccggctggaaggcaag
ctctcgggcaacgcggcggtgcgcgaatggttcgacacccgtcattttcccgccctgttc
caggcccaacgcaagaaggggaatgccagccgggagatcttctgcctgatgcagtttgcg
atctggcaccggctgtttatcgaccaaccgggactcaagccgtcgcccgacgaggacccg
ctcgactggatcagctga

DBGET integrated database retrieval system