KEGG   Methylococcus capsulatus: MCA2203Help
Entry
MCA2203           CDS       T00205                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mca  Methylococcus capsulatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MCA2203 (galU)
   00052 Galactose metabolism
    MCA2203 (galU)
   00500 Starch and sucrose metabolism
    MCA2203 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MCA2203 (galU)
Enzymes [BR:mca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MCA2203 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2380159..2381037)
Genome map
AA seq 292 aa AA seqDB search
MAKVIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAVAAGIDEMVFITGR
SKNAIMDHFDKAYELETELAARGKDDILNIVRNIIPPHVTCIYIRQAEALGLGHAVNCAK
AVIGNQPFAVLLADDLIDGNNHGGCLSQMVRVFDKWQCSVLGIERIDPGDTHSYGIVKTS
PIEAGLDKVEAIVEKPRPENAPSNQAVVGRYILTPAIFDKLANVSRGAGGEIQLTDAIAM
LLNEQTVLAYEFNGKRYDCGSKLGYLIATVEQGLQHPDLRAGFEAYLRSLQL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtcatcagaaaagccgttttcccggtcgcggggctggggacccgcttcctg
cccgccaccaaggccagcccgaaggaaatgctgccggtggtggacaagccgttgatccaa
tatgcggtggaagaagccgtggcggccggcatcgacgagatggtgttcatcaccggccgc
agcaagaacgcgatcatggaccatttcgacaaggcctacgaactcgagacggaactggcg
gcgcgaggcaaggacgacatcctgaacatcgtccggaacatcattccgccgcacgtcacc
tgcatctacatccgtcaggccgaagcgctggggctgggccatgccgtcaactgcgccaag
gcggtcatcggcaaccaaccgttcgcggtgctgctcgccgacgatctcatcgacggcaac
aaccacggcggctgtctgtcacagatggtccgggtattcgacaaatggcagtgctcggtg
ctgggcatcgagcgcatcgatcccggcgacactcacagctacggcatcgtgaagaccagt
ccgatcgaggccgggctggacaaggtcgaagcgatcgtggaaaagccgcggcccgagaac
gcgccatccaaccaggccgtggtgggacgctacatcctcacgccggcgatcttcgacaag
cttgccaatgtctcgcgcggcgcgggcggggaaatccagctcaccgacgccatcgccatg
ctgctcaacgagcagacggtgttggcctacgaattcaacggcaagcgttacgattgcgga
tcgaagctgggctatctcatcgccacggtggaacagggcctgcagcatcccgatttgcgg
gctggcttcgaagcctatctgcggagtctgcagctctag

DBGET integrated database retrieval system