KEGG   Methylococcus capsulatus: MCA2313Help
Entry
MCA2313           CDS       T00205                                 

Gene name
folK-1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mca  Methylococcus capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2507044..2507541
Genome map
AA seq 165 aa AA seqDB search
MSGESKAYIGLGGNLGNAAETVRTARRAIGAIPGVRELAFSSLYRSAPMGPSDQPDYVNA
VMAVATSLAPQALLHALQRIERIHGRVRTGERWGPRTLDLDLLLYDDLVLDTETLRLPHP
GIAEREFVLYPLAEIAPDLDIPDRGPLRELVRNCPLRGLSVIAHD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgaaagcaaggcctacatcggtctcggcggcaatctcggcaatgcggccgaa
accgtgcggaccgcccggcgggccatcggtgccatccccggcgtgcgggaactcgccttt
tccagcctttaccgcagtgctccgatggggccgagcgaccagccggattacgtcaatgcc
gtcatggccgtcgccacctccctggcaccgcaggcgctgctccacgccctgcaacggatc
gagcggatccacggccgggtacgcaccggcgaacgctgggggccccggacgctcgacctc
gacctgctgctctacgacgatctcgtactcgacacggagaccctgaggctgccgcatcct
ggcatcgccgaacgggaatttgtgctgtatccgctggcggaaatcgcgcccgacctcgac
attcccgaccggggccccttgcgagaactggtccggaactgccccttgcggggcctctcg
gtcatcgcccatgactga

DBGET integrated database retrieval system