KEGG   Methylococcus capsulatus: MCA2317Help
Entry
MCA2317           CDS       T00205                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mca  Methylococcus capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2509686..2510570)
Genome map
AA seq 294 aa AA seqDB search
MRSNRMAGPKSPDRSMNRLLALLAQDRPLIMGILNVTPDSFSDGGLYDDVEQAVRRGVFM
AGEGADVIDVGGESTRPGAEPVEAAVQLARVVPVIERLRGLLPGRVAISVDTTQGEVARA
ALRAGADLINDVSAGRDDSAMLPLAAAERAPVVLMHMQGTPLTMQERPHYEDVVAEVLAF
LLERAEAAGRAGVPHDSILLDPGIGFGKRRDDNLKLMAHLDRFVATGYPVLLGTSRKRFM
GAVCGETEPAALVPATVATTALGVSAGVRVFRVHDVKENRQAADVAEAIRRARL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgaatagaatggcaggcccgaaatcgcccgaccgttccatgaaccgattgctc
gcattgctcgcccaggatcgcccgctgatcatgggcatcctcaacgtcacccccgacagt
ttctccgacggcggcctgtatgacgatgtcgagcaggccgtccgccgcggcgtgttcatg
gcgggggaaggcgccgacgtgatcgacgtggggggagagtcgacccggccgggagctgag
ccggtcgaggccgcggtccaactggctcgtgtggtgccggtcatcgaacgcctgcggggg
ctgctccccggacgggtggcgatcagcgtcgatacgacacagggggaagtggcccgcgcg
gccctgagggccggtgccgatctgatcaacgacgtgtccgcggggcgggatgattccgcg
atgctgccgctggcggcggccgagcgcgcgccggtcgtgctgatgcacatgcagggtacg
cctttgaccatgcaggagcgaccgcattacgaagacgtggttgccgaagtgctggcgttc
ctgctggagcgggcggaggcagccgggcgcgccggcgttccgcacgactccatcctgctc
gatccgggcatcggcttcggcaagcggcgggacgacaatctgaagctgatggcccacctg
gaccgcttcgtcgcaacggggtatccggtgctgctgggcaccagccggaagcgcttcatg
ggggcggtctgcggcgaaaccgagccggcggcgctggtgccggcgacggtggcgacgact
gcgctgggtgtatcagccggcgtgcgggtgttccgggttcacgacgtgaaggagaatcgg
caggcggcggatgtcgcggaggcgatccgccgagcgcggctttag

DBGET integrated database retrieval system