KEGG   Methylococcus capsulatus: MCA2318Help
Entry
MCA2318           CDS       T00205                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09007  
GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
mca  Methylococcus capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCA2318
Enzymes [BR:mca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MCA2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2510622..2511428)
Genome map
AA seq 268 aa AA seqDB search
MEEEGLAIDDVQGRADLRRIDIDRVGIKGIRHPVRVRDRSLGEQHTVARFDMAVSLPHHF
KGTHMSRFVEIINGHDREIDIASFEAMLAEMMQRLNAEAGRIEMRFPYFLEKRAPVTGVR
SLMDYEVALIGEVSVATTTTWLGVTVPVTSLCPCSKAISERGAHNQRSHVTTAVRMRDFV
WIEELIEWVEAEASSPIYGLLKRPDEKYVTEYAYDHPRFVEDLVRGVAARLDTEPRIAAY
AVEVENFESIHNHSAYALIERDKRTADA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaaggtctggccatcgacgacgtgcaaggccgagcggacctgcgccggata
gacatcgacagggtcgggatcaagggcattcgccatccggtgagggtccgggatcgaagt
ctgggcgaacagcacaccgtcgcccgtttcgacatggcagtgagtctgccgcaccatttc
aagggaacccatatgtcgcgcttcgtggagatcatcaatggccacgaccgcgagatcgac
atcgcctccttcgaggcgatgctggcggaaatgatgcagcgcctgaacgccgaggcgggt
cgcatcgaaatgcgttttccctattttctggaaaaacgcgcgccggtgacaggtgtccgg
agtctcatggattacgaggtcgccttgatcggcgaagtttccgtcgccacaacgacgaca
tggcttggtgtgaccgtgccggtcaccagcctgtgcccttgttccaaggcgatttccgaa
cgcggcgctcacaaccagcgctctcatgtcacgaccgccgtgcgcatgcgtgatttcgtg
tggatcgaagagctgatcgagtgggtggaggcagaggcctcctcgccgatttacggcctc
ctgaaacgtcccgacgaaaagtacgtcaccgaatacgcctatgaccatccccgcttcgtg
gaggatctggtacgcggcgtggccgcccgcctggacaccgaaccgcgcatcgcggcatat
gcggtcgaggtggaaaatttcgagtccatccacaaccattcggcctatgcgctgatcgag
cgcgacaagcggacggcggacgcttga

DBGET integrated database retrieval system