KEGG   Methylococcus capsulatus: MCA2419Help
Entry
MCA2419           CDS       T00205                                 

Gene name
pcm-2
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mca  Methylococcus capsulatus
Brite
Enzymes [BR:mca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MCA2419 (pcm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD
Motif
Other DBs
NCBI-ProteinID: AAU91498
UniProt: Q604W7
Position
2595383..2596042
Genome map
AA seq 219 aa AA seqDB search
MNVRLQGIGMTSPRTRERMVGRLRELGIRHPRVLTAMRSIPRHIFVEEAFASRAYEDMAL
PIGFGQTISRPYTVARMTELLLEDGPLRRVLEVGTGSGYQTAVLAQLVGTVYSVERVHAL
QERAIRSLADLNLRNVRLKHGDGHLGWRESGPFDGIIVTAAPPRLPAALLDQLNPGGVLV
APIGVGRQQTLERIMRTDAGYEARSVEPVVFVPLLAGTV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccgcctgcagggcatcggcatgacgtcgccgcgcacccgcgagcgcatggtc
ggccgcctacgggaactggggatccgccaccccagggtgctgaccgccatgcgcagcatc
ccccgccacatcttcgtcgaagaggctttcgccagccgggcgtacgaagacatggccctg
ccgatcggcttcggccagaccatctcgcggccttacacggtcgcccgcatgaccgaactc
ctgctcgaggacggccccttgcgccgcgtgctggaagtgggcaccggctccggctaccag
accgccgtcctggcccaactggtcggcaccgtctattcggtggagcgcgtccatgcccta
caggagcgggccatccgcagcctggccgacctgaacctccggaacgtgcggctgaaacac
ggcgatggccatctgggctggcgcgaatccggcccgttcgacgggatcatcgtgaccgcc
gccccgccgcgcctgccggctgcgttgctggaccagctcaatcccggcggcgtgctcgtc
gctccgatcggcgtgggccggcaacagacgctcgaacgcatcatgcgtaccgacgcgggc
tacgaagcccgctccgtggagccggtcgtgttcgttccgctgctggccggcacggtgtaa

DBGET integrated database retrieval system