KEGG   Methylococcus capsulatus: MCA2495Help
Entry
MCA2495           CDS       T00205                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mca  Methylococcus capsulatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCA2495 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCA2495 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCA2495 (trpB)
Enzymes [BR:mca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCA2495 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2676423..2677640)
Genome map
AA seq 405 aa AA seqDB search
MIMQDEIQPYDLPDELGHFGPYGGIFVAETLMEPLEELKAAYHRYLKDPEFLAELDHDLN
HYVGRPSPIYHAERLSRELGGAQIFFKREDLNHTGAHKVNNTVGQALLAKRMGKRRVIAE
TGAGQHGVATATVAARLGMECVVYMGAVDVQRQALNVFRMKLLGATVIAVDSGSRTLKDA
LNEAMRDWVTNVDDTFYIIGTVAGPHPYPAMVRDFQAVIGREARRQMLEMTGRLPDALVA
CVGGGSNAIGLFHPFVDDREVAMYGVEAAGDGIETGRHSAPLSAGRPGVLHGNRTYLMED
EDGEIIETHSISAGLDYPGVGPEHAWLKDCGRASYVSATDAEALEAFHILTRSEGIIPAL
ESSHAVAYALKLAPTLSSDKIVLVNLSGRGDKDIHTIATREGIVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatgcaagacgagattcagccctatgacctgcccgatgagctcggccactttgga
ccttacggtggcattttcgtcgccgagaccttgatggagccgctggaagagctgaaagcc
gcctaccatcgctacctgaaggacccggaattcctcgccgagctggatcacgatctgaac
cactacgtcggccgcccctcaccgatctaccatgccgaacgcctgagccgggagctcggc
ggcgcacagatcttcttcaagcgcgaagatctcaatcataccggtgcacacaaggtcaac
aacaccgtcggccaggcactgctggccaagcgcatgggcaagcggcgggtgatcgccgag
accggtgccggccagcacggcgtggccacggccaccgtggcggcccggctggggatggag
tgcgtggtctacatgggggcggtcgacgtccagcgccaggcgctcaacgtattccgcatg
aagctgctcggcgccaccgtgatagcggtcgactcgggttcccggacgctcaaggacgcg
ctgaacgaagccatgcgcgactgggtgaccaacgtcgacgataccttctacatcatcggt
acggtggcgggtccccatccctatcccgccatggtgcgcgatttccaggccgtgatcggc
cgcgaggcgcgccggcagatgctggagatgacggggcgtctgcccgatgccctggtcgcc
tgcgtgggcggcggctcgaatgccatcggcctgtttcatccgttcgtcgatgaccgcgag
gtcgccatgtacggggtcgaggccgccggggatggtatcgaaaccggtcgccactcggct
ccgctgagcgccggccgccccggcgtgctgcacggcaaccgtacctacctgatggaagac
gaagacggcgagatcatcgagacccattccatttccgccgggctggactatccgggcgtc
gggccggaacacgcctggctcaaggactgcggccgggcgagctatgtcagtgccaccgac
gccgaagcgctcgaggcgttccatatcctgacccggtccgaggggatcatcccggcactg
gaatccagccatgccgtggcctacgccctcaagctggcgccgactctcagttccgacaag
atcgtcctggtcaacctgtctggccgtggcgacaaggatatccacaccatcgccacccgg
gagggcatcgttctgtga

DBGET integrated database retrieval system