KEGG   Methylococcus capsulatus: MCA2495Help
Entry
MCA2495           CDS       T00205                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mca  Methylococcus capsulatus
Pathway
mca00260  Glycine, serine and threonine metabolism
mca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01130  Biosynthesis of antibiotics
mca01230  Biosynthesis of amino acids
Module
mca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCA2495 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCA2495 (trpB)
Enzymes [BR:mca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCA2495 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAU91370
UniProt: Q604P3
Position
complement(2676423..2677640)
Genome map
AA seq 405 aa AA seqDB search
MIMQDEIQPYDLPDELGHFGPYGGIFVAETLMEPLEELKAAYHRYLKDPEFLAELDHDLN
HYVGRPSPIYHAERLSRELGGAQIFFKREDLNHTGAHKVNNTVGQALLAKRMGKRRVIAE
TGAGQHGVATATVAARLGMECVVYMGAVDVQRQALNVFRMKLLGATVIAVDSGSRTLKDA
LNEAMRDWVTNVDDTFYIIGTVAGPHPYPAMVRDFQAVIGREARRQMLEMTGRLPDALVA
CVGGGSNAIGLFHPFVDDREVAMYGVEAAGDGIETGRHSAPLSAGRPGVLHGNRTYLMED
EDGEIIETHSISAGLDYPGVGPEHAWLKDCGRASYVSATDAEALEAFHILTRSEGIIPAL
ESSHAVAYALKLAPTLSSDKIVLVNLSGRGDKDIHTIATREGIVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatgcaagacgagattcagccctatgacctgcccgatgagctcggccactttgga
ccttacggtggcattttcgtcgccgagaccttgatggagccgctggaagagctgaaagcc
gcctaccatcgctacctgaaggacccggaattcctcgccgagctggatcacgatctgaac
cactacgtcggccgcccctcaccgatctaccatgccgaacgcctgagccgggagctcggc
ggcgcacagatcttcttcaagcgcgaagatctcaatcataccggtgcacacaaggtcaac
aacaccgtcggccaggcactgctggccaagcgcatgggcaagcggcgggtgatcgccgag
accggtgccggccagcacggcgtggccacggccaccgtggcggcccggctggggatggag
tgcgtggtctacatgggggcggtcgacgtccagcgccaggcgctcaacgtattccgcatg
aagctgctcggcgccaccgtgatagcggtcgactcgggttcccggacgctcaaggacgcg
ctgaacgaagccatgcgcgactgggtgaccaacgtcgacgataccttctacatcatcggt
acggtggcgggtccccatccctatcccgccatggtgcgcgatttccaggccgtgatcggc
cgcgaggcgcgccggcagatgctggagatgacggggcgtctgcccgatgccctggtcgcc
tgcgtgggcggcggctcgaatgccatcggcctgtttcatccgttcgtcgatgaccgcgag
gtcgccatgtacggggtcgaggccgccggggatggtatcgaaaccggtcgccactcggct
ccgctgagcgccggccgccccggcgtgctgcacggcaaccgtacctacctgatggaagac
gaagacggcgagatcatcgagacccattccatttccgccgggctggactatccgggcgtc
gggccggaacacgcctggctcaaggactgcggccgggcgagctatgtcagtgccaccgac
gccgaagcgctcgaggcgttccatatcctgacccggtccgaggggatcatcccggcactg
gaatccagccatgccgtggcctacgccctcaagctggcgccgactctcagttccgacaag
atcgtcctggtcaacctgtctggccgtggcgacaaggatatccacaccatcgccacccgg
gagggcatcgttctgtga

DBGET integrated database retrieval system