KEGG   Methylococcus capsulatus: MCA2523Help
Entry
MCA2523           CDS       T00205                                 

Gene name
panE
Definition
2-dehydropantoate 2-reductase (EC:1.1.1.169)
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
mca  Methylococcus capsulatus
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:mca00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
2698700..2699638
Genome map
AA seq 312 aa AA seqDB search
MNILVIGTGAIGSFYGALLAKTGHCVSVVSRSDYETVKAKGIRIRSATLGDYTFRPAAVV
RSAAELETKPDCTLLCIKVVEGADRVGLLRDAVAPDTGIVLISNGIDIEPEVAAAFPDNE
VISGLAFIGVTRTAPGEIWHQAYGRLMLGNYPGGVSERVKTLAAAFEEAGIDGIATENIT
TARWQKCVWNAAFNPLSVLSGGLDTLDILSTQEGFVRAIMQEIRAVAAANGHPLPEDIVE
KNVASTYKMPPYKTSMLVDFEAGQPMETEVILGNAVRAGRRTRVAIPHLESVYALMKLLE
LRTSKSLWGNPP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatatactcgtgatcggcaccggcgccatcggcagcttctacggtgccctgctcgcc
aagaccggccactgcgtgtcggtggtctcccgctccgactacgagaccgtgaaggccaag
ggcatccgcatccgcagcgcgacactgggggactataccttccggccggcggcggtcgtc
cgctccgccgccgaactcgaaaccaaacccgattgtacgctgctgtgcatcaaggtggtg
gaaggtgccgaccgggtcggattactgcgcgatgccgtggcccccgacaccggcatcgtc
ctgatttccaacggcatcgacatcgagccggaagtcgccgccgccttccccgacaacgaa
gtcatcagcggcctggccttcatcggcgtcacccgtaccgcgcccggcgagatctggcac
caagcctacgggcggctgatgctgggcaactatcccggcggagtctcggaacgcgtcaag
accttggccgccgctttcgaagaagccggcatcgacggcatcgccactgaaaacatcacc
accgcacgctggcagaaatgcgtctggaacgccgccttcaatccactgtcggtgctctcc
ggcggcctcgataccctggatatcctgtcgacccaggagggtttcgtccgggcgatcatg
caggagatccgcgcagtagccgcggccaacggccatcccctgccggaagacatcgtcgag
aagaacgtcgccagcacctacaagatgccgccgtacaagaccagcatgctggtcgacttc
gaagccggccagccgatggaaacggaggtcatcctcggcaacgcggtacgcgccggccgg
cggacccgtgtggcgattccgcatctggagtcggtctatgccctaatgaagctcctggag
ctacgaacctcgaaaagcctttggggaaacccgccgtga

DBGET integrated database retrieval system