KEGG   Methylococcus capsulatus: MCA2680Help
Entry
MCA2680           CDS       T00205                                 

Definition
prophage LambdaMc01, lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mca  Methylococcus capsulatus
Brite
Enzymes [BR:mca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     MCA2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2861603..2862061
Genome map
AA seq 152 aa AA seqDB search
MIAVPQTAIDLAKRFEGFHRVPKTDPGRAHPYICPAGYWTIGYGHLCDSTHAPITEAEAE
VYLARDLQMALAATLRYCPVLATESEGRLAAIVDFTFNLGAGRLQTSTLRRRVNQRDWMA
AGDEIQRWAYGGGKVLPGLVLRRKAERVLLGG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcggtgccgcagacagccatcgacctggccaagcgcttcgagggcttccaccgc
gtgccgaagaccgatccgggccgtgcgcatccgtacatctgcccggccggctattggacg
atcgggtacggacatctctgcgactcgacgcatgcgccaatcaccgaggccgaagcggaa
gtctatctggcccgtgacctgcagatggcgctcgccgccacattgcgctactgcccggtg
ctggccaccgagtccgaggggcggcttgcagccattgtggatttcacgttcaacctcggc
gccggtcggctccagacgtcgacgctgcggcgacgggtcaatcagcgggactggatggcc
gctggtgacgagatccaacgctgggcctatgggggtgggaaggttcttcctgggctcgtc
ctgcggcgcaaggccgaacgggtattgctgggcggctaa

DBGET integrated database retrieval system