KEGG   Methylococcus capsulatus: MCA2761Help
Entry
MCA2761           CDS       T00205                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mca  Methylococcus capsulatus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mca00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2955716..2956312)
Genome map
AA seq 198 aa AA seqDB search
MNTKTYPYRLSPGDALIVVHVQNDFLPGGSLAVPGGDEVIPVLNRHIARFVQEGLPIIAT
RDWHPPDHCSFHAQGGPWPPHCVAGSAGAEFAPGLALPEDVPVVSQATWPDKEAYSSFEG
TDLAYLLQEIGVRRLFIGGLATDYCVLRTVLDARRLGFDVVVLEDAVRAVDAEPEDGRRA
LARMREEGAEFADCKDFE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaagacttacccctaccgtctttcgccgggtgatgccttgatcgtggtccac
gtgcagaacgactttctgccgggcggcagtcttgccgtccccggtggggacgaggtgatt
ccggtcctgaatcggcacatcgcacgcttcgtccaggaagggttgcccatcatcgccacg
cgcgactggcatccgccggaccattgctcgttccatgcccagggcggaccctggccgccg
cactgcgtggccggcagcgcgggagcggagttcgcgcctggtctcgcgctacccgaggac
gttcccgtcgtgtcccaggcgacgtggccggacaaggaagcctactccagtttcgaaggc
acggatctggcctacctcctgcaggaaatcggcgttcgccggttgttcatcgggggcctg
gcgaccgactattgcgtgttgcgtaccgtgctcgatgcccggcgtctgggcttcgacgtc
gtcgttctcgaagacgcggtgcgcgccgtcgatgcggagccggaagacggccgccgcgcg
ttggcccggatgagggaggaaggtgcggaattcgccgactgcaaggatttcgaatga

DBGET integrated database retrieval system