KEGG   Methylococcus capsulatus: MCA2782Help
Entry
MCA2782           CDS       T00205                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase family protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mca  Methylococcus capsulatus
Pathway
mca00010  Glycolysis / Gluconeogenesis
mca00030  Pentose phosphate pathway
mca00051  Fructose and mannose metabolism
mca00052  Galactose metabolism
mca00230  Purine metabolism
mca00500  Starch and sucrose metabolism
mca00520  Amino sugar and nucleotide sugar metabolism
mca00521  Streptomycin biosynthesis
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
mca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCA2782
   00030 Pentose phosphate pathway
    MCA2782
   00051 Fructose and mannose metabolism
    MCA2782
   00052 Galactose metabolism
    MCA2782
   00500 Starch and sucrose metabolism
    MCA2782
   00520 Amino sugar and nucleotide sugar metabolism
    MCA2782
  Nucleotide metabolism
   00230 Purine metabolism
    MCA2782
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCA2782
Enzymes [BR:mca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MCA2782
    5.4.2.8  phosphomannomutase
     MCA2782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAU91112
UniProt: Q603M2
Position
complement(2972945..2974336)
Genome map
AA seq 463 aa AA seqDB search
MEIEPIPSIAPTLFRAYDIRGIVGDTLTEAAARAIGRAVGSEALDRGERQVVVARDGRLS
SPALGAALAEGLRMAGCQVTDLGLAPTPVLYFGTHVLAGRSGVMVTGSHNPANYNGFKIV
LAGQTLAGEDIQRLRQRIETGDFRTGEGEIERRDLLSDYQRRIVDDVQLGRPFKVVVDCG
NGVAAVVAPQVLRAMDCEVVELFCTVDGNFPHHHPDPSKPENLAALIETVKREGADLGVA
FDGDGDRLGVVDSAGNVIWPDRQMMLFAADVLSREPGADIIYDVKCTRHLAGYILRHGGR
PLMWKTGHSLIKAKMKETGALLAGEMSGHFFFRERWYGFDDGIYACARMVEILSADSRAT
AEVFAELPDSVNTPELGVRLQEGENLAFVERMRALADFDDGRITDIDGLRVDFADGWGLV
RASNTTPSLVIRFEADTAEGLARIQQRFRALLLKVRPGLELPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgagccgattccatccatcgcccccaccctgttccgggcctacgacattcgc
ggcatcgtcggcgacaccttgacggaggctgcggcccgagcgatcggccgggccgtcggc
agcgaagcgctcgaccgcggcgaacggcaggtcgtcgttgcccgcgacgggcggctgagc
agccccgcgcttggcgccgcgctggcggaggggctgcggatggccggctgccaggtcacc
gatctggggctggcgcccacgccggttctctatttcggcacccatgtgctggcggggcgt
tccggcgtgatggtgaccggcagccacaatcccgcgaattacaatggcttcaagatcgtg
ctggcaggacagacgctggccggcgaggatattcagagactgaggcagcgtatcgaaacg
ggggacttccggaccggggagggggagatcgagcgtcgggatctgctgtccgattaccaa
cggcgtatcgtggacgacgtacagctcggccggccgttcaaagtcgtggtcgattgcggc
aacggcgtggcggcggtggtggcgccacaggtcctccgggccatggattgcgaagtggtc
gaattgttctgcaccgtcgacggcaatttcccccatcatcatcccgatccgagcaagccg
gagaacctggcggcgctgatcgaaacggtcaagcgggaaggcgcggatctgggcgtggcc
ttcgacggcgatggcgaccggctcggcgtggtcgactcggccggcaacgtcatctggccg
gatcggcagatgatgctgttcgccgccgacgtgctgtcccgcgagccgggcgcggacatc
atctacgacgtcaaatgcacccgtcatctggcgggctacattctgcgtcacgggggccgc
ccgctgatgtggaagaccggccattccctgatcaaggccaagatgaaggaaaccggcgct
ctgctggcgggggagatgagcggccacttcttcttcagggagcgctggtacggtttcgac
gacggcatctacgcctgcgcccggatggtggaaatcctgtctgccgattctcgcgccacc
gcggaagtgttcgcggaactgccggacagcgtcaacacgcctgaactcggtgtgcggttg
caggagggcgaaaacctcgccttcgtcgaaagaatgcgtgccctggccgatttcgatgat
ggtcgcatcacggacatcgacggcctgcgggtcgatttcgccgacggttgggggctggta
cgcgcctccaataccacgccttccctggtgatccgcttcgaagccgataccgccgaaggg
ctggcccgcatccagcagcgcttccgggcgcttctgctgaaggtgcggcccggtctcgag
ctgcctttctag

DBGET integrated database retrieval system