KEGG   Methylococcus capsulatus: MCA2975Help
Entry
MCA2975           CDS       T00205                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mca  Methylococcus capsulatus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MCA2975 (gmk)
Enzymes [BR:mca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MCA2975 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3150827..3151441
Genome map
AA seq 204 aa AA seqDB search
MTQGLLYVISAPSGAGKTSLVSALCAGAPDLAVSVSHTTRPQRPGEVPGQDYWFVDKAEF
EKMIANEAFLEYARVFDNYYGTAKTTVEEVLATGRDAVLEIDWQGARQVRRLMPACVSVF
ILPPSRQALEQRLRTRQQDSEAVIARRMEAAISEMSHYAEYDYLIVNDDFNLALNQLRAI
VQTQRLTVQRQAPRLGRLIADLLG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacacagggactcctttacgtcatctccgccccctcgggcgcaggaaaaaccagtctg
gtcagcgcgctgtgcgctggtgctccggacctcgcggtgtcggtgtcgcacacgacccgc
ccccagcggcccggtgaagtgcccggccaggactactggttcgtggacaaggcggagttc
gaaaaaatgatcgcgaacgaagcatttctggaatacgcccgtgttttcgacaactattac
ggcacggcgaaaacgacggtcgaggaggtgctggcgaccgggcgagacgccgtcctcgaa
atcgactggcaaggcgcccgccaggtccgccgactgatgcccgcatgcgtgtcggtcttc
atcctgccgccctcccgtcaggcgctggaacaacgcctgcgcacccgccagcaggattcc
gaagcggtgatcgcccgccgcatggaggcagccatttccgaaatgtcgcattatgcggaa
tacgattacctgatcgtcaacgacgacttcaacctcgccctgaaccagctccgtgccatc
gtccaaacccagcgcctcaccgtccagcgccaggcgccgcggctgggacgcctgatcgcc
gatcttctgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system