KEGG   Methylococcus capsulatus: MCA2987Help
Entry
MCA2987           CDS       T00205                                 

Gene name
folK-2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mca  Methylococcus capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCA2987 (folK-2)
Enzymes [BR:mca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MCA2987 (folK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3161584..3162078)
Genome map
AA seq 164 aa AA seqDB search
MPEVFVSIGSNVDRDRHIPSALTALRDAFGPLRVSSVYETAAVGFEGDPFYNLVVGFTTE
RPLADVANELARIEADHGRTRESKKFSARTLDLDLLLYGDAVVSEGKLRLPRKELTEYAF
MLEPLAEIAPDLKHPVLEVSFRELWERYDKTGLQQVRIRPSWHS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggttttcgtcagcatcggcagcaacgtcgaccgggacaggcatattccttcg
gcgctcacggcactgcgcgatgctttcggaccgctgcgcgtgtccagcgtctacgagacg
gccgccgtggggttcgagggcgaccctttctacaacctcgtcgtgggattcacgacggag
cggccgctcgccgatgtcgctaatgaactggcccggatcgaagcggatcatggacgtacg
cgggagtcgaagaaattcagcgccaggaccctggacctcgacctgctgctatacggcgat
gcggtcgtcagcgaagggaagctcaggcttccgcgcaaagagctgaccgaatacgccttc
atgctcgagccgcttgcggaaatcgcgccggatttgaagcatccagtcctggaagtgagc
tttcgggagctttgggagcgttacgacaagaccggtctgcaacaggtgcgcatccgcccg
tcttggcattcctag

DBGET integrated database retrieval system