KEGG   Methylococcus capsulatus: MCA3061Help
Entry
MCA3061           CDS       T00205                                 

Gene name
hemDX
Definition
(GenBank) uroporphyrinogen-III synthase/uroporphyrin-III C-methyltransferase
  KO
K13543  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mca  Methylococcus capsulatus
Pathway
mca00860  Porphyrin and chlorophyll metabolism
mca01100  Metabolic pathways
mca01110  Biosynthesis of secondary metabolites
mca01120  Microbial metabolism in diverse environments
Module
mca_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCA3061 (hemDX)
Enzymes [BR:mca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MCA3061 (hemDX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MCA3061 (hemDX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemX HEM4 IncA Baculo_PEP_C DASH_Hsk3 CLZ HAUS-augmin3 FAM184 Cast LPP FAM76 MscS_porin
Motif
Other DBs
NCBI-ProteinID: AAU90857
UniProt: Q602K2
Position
3245998..3248016
Genome map
AA seq 672 aa AA seqDB search
MRVLVTRPKEQAEPLCRLIETAGGKAVRFPLLDIEPSAQAEEGAALLRQASDWDWWIFVS
VNAVNRARALDVLRPDGAGPRIAAIGKATADALVDGGIAVDLVPESQANSEGLLETPPMR
DVAGRRILIVRGEGGRETLKERLVERGALVQYAELYRRVPVHTGAEALIEGLRTAGLDML
TATSGEAIEHLYRLVPPEDRPRLVETPLVVISERLKNQAGSLGFRHVKVADAASDAAVLQ
ALEDVAARLASLRAAPNDGDKPLAEEEKQMTEAPQSPAAGEVSRHPHGNAAAPPVHPPRR
SRVVAWLGYSMLAAILLLATAGYFLIQELRSKQEGLGGELNKGDLHLLELSRQVSSLQTQ
LATLHSQFATLQSQLGTEDSKLERLLGEQSASFGQRLEDSRKELTRSIETLQRQLSRTHS
DVLIADAEYLLGIANQKLHLTGDVKSVLEAMKAADQRLRDSDDPGVFKVREVLAEEINRL
EAFQPPDVVGLSARLLAIEAKTRELPLFLPHPDMSKEPRETSKPKSPEPETGDAVESTLE
QLKGLVTVRRSDRPVHAVLTPQEAAGLREILLLKLEMTRTSLLRGDDALFHSNLESANAW
LNENFDRESPAFKDISDDLRALAGVQLKAAFPDISGSLALLRNIEKLRLETDPVAPASTA
APAGNEAPGDRP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctcgtcacgcgaccgaaggaacaggccgaacccctgtgcaggctgatcgaa
acggcaggcggcaaggcggtccgtttccccctgctcgacatcgagccgagcgcgcaggcg
gaagagggagcggctctcctccggcaggcatcggattgggactggtggatcttcgtcagc
gtcaacgcggtgaaccgggcccgggctctggatgtgcttcggccggacggtgccgggccg
cgcatcgccgccatcggcaaagccacggccgatgccctggtcgacggcgggattgccgtg
gacctcgttccggaatcgcaggccaattcggaaggactgctggagacgcccccgatgcgg
gacgtcgcaggccggcggatcctcatcgtgcgcggcgagggcgggcgggaaacgctcaag
gaacggcttgtcgaacgtggggcactggtccagtatgccgagctgtaccggcgggtgccg
gtgcacacgggtgccgaagcactgatcgaaggcctgcggaccgccgggctcgacatgctg
accgccaccagcggcgaagccatcgagcatctgtaccgcctggttccacccgaggaccgg
ccgcggctggtcgagacgccgctggtcgtcatcagcgaacgattgaaaaatcaagccgga
tcgctgggtttccggcacgtgaaggtggccgacgccgcatcggatgccgccgtgctgcaa
gccctggaggatgtcgcagcccgtttggcatccttgcgagccgcgcccaacgacggggat
aagccattggccgaggaagaaaaacaaatgaccgaagcgccgcaatcaccggcagccggg
gaagtctcccgacacccgcacggcaacgctgccgcgcctccggtgcatccgccgcgcaga
tcgcgggtagtcgcctggctgggctactcgatgctggccgccattctgctgctggccacc
gccggctatttcctgatccaggaactgcgctccaagcaggagggtctgggcggcgagctc
aacaagggcgatctgcacttgctggaactcagccgccaggtcagcagcctgcagactcaa
ctcgccaccctccattcccagttcgccaccctccagtcccagctcgggacggaggacagc
aagctggagcgtctgctcggcgagcaatccgccagtttcggccagaggctcgaggacagc
cgcaaagaactgacgcggtccatcgagaccctccagcgtcaactaagccggacccacagc
gatgtcctgatcgcggatgccgaatatcttttgggcattgccaatcagaagctgcacctc
accggtgacgtgaaatccgtcctcgaagccatgaaggccgcggaccaaagactccgtgac
agcgacgaccccggcgtgttcaaggtgcgggaggtcttggcggaggaaatcaaccgactc
gaggccttccagccgcccgacgtggtcggactgtcggccaggctgctggcgattgaagcc
aagacgcgggagctgccgctgttcctgccacatcccgacatgtcgaaggaaccgcgcgag
acgtccaagcccaaatcaccggaacccgaaaccggcgatgccgtcgagtccaccctcgag
cagctcaagggactggtcaccgtgcgccgcagcgaccgccccgtgcatgccgtcctgact
ccccaggaggccgccggcctccgggaaatcctgctgctcaaactggagatgacccgcacc
tccctgttgcgcggcgacgatgcactgttccacagcaatctggaatccgcaaacgcctgg
ctgaacgaaaatttcgaccgcgagtcccccgccttcaaggacatctcggacgatctccgg
gccctggccggcgtccagctcaaggccgccttccccgacatcagcggatcactcgccttg
ctccgcaacatcgaaaaactgcggctcgaaaccgaccccgtcgcaccggcaagcacggcc
gcccccgccgggaatgaagcgccgggagacagaccgtga

DBGET integrated database retrieval system