KEGG   Methylococcus capsulatus: MCA3061Help
Entry
MCA3061           CDS       T00205                                 

Gene name
hemDX
Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mca  Methylococcus capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCA3061 (hemDX)
Enzymes [BR:mca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MCA3061 (hemDX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MCA3061 (hemDX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3245998..3248016
Genome map
AA seq 672 aa AA seqDB search
MRVLVTRPKEQAEPLCRLIETAGGKAVRFPLLDIEPSAQAEEGAALLRQASDWDWWIFVS
VNAVNRARALDVLRPDGAGPRIAAIGKATADALVDGGIAVDLVPESQANSEGLLETPPMR
DVAGRRILIVRGEGGRETLKERLVERGALVQYAELYRRVPVHTGAEALIEGLRTAGLDML
TATSGEAIEHLYRLVPPEDRPRLVETPLVVISERLKNQAGSLGFRHVKVADAASDAAVLQ
ALEDVAARLASLRAAPNDGDKPLAEEEKQMTEAPQSPAAGEVSRHPHGNAAAPPVHPPRR
SRVVAWLGYSMLAAILLLATAGYFLIQELRSKQEGLGGELNKGDLHLLELSRQVSSLQTQ
LATLHSQFATLQSQLGTEDSKLERLLGEQSASFGQRLEDSRKELTRSIETLQRQLSRTHS
DVLIADAEYLLGIANQKLHLTGDVKSVLEAMKAADQRLRDSDDPGVFKVREVLAEEINRL
EAFQPPDVVGLSARLLAIEAKTRELPLFLPHPDMSKEPRETSKPKSPEPETGDAVESTLE
QLKGLVTVRRSDRPVHAVLTPQEAAGLREILLLKLEMTRTSLLRGDDALFHSNLESANAW
LNENFDRESPAFKDISDDLRALAGVQLKAAFPDISGSLALLRNIEKLRLETDPVAPASTA
APAGNEAPGDRP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctcgtcacgcgaccgaaggaacaggccgaacccctgtgcaggctgatcgaa
acggcaggcggcaaggcggtccgtttccccctgctcgacatcgagccgagcgcgcaggcg
gaagagggagcggctctcctccggcaggcatcggattgggactggtggatcttcgtcagc
gtcaacgcggtgaaccgggcccgggctctggatgtgcttcggccggacggtgccgggccg
cgcatcgccgccatcggcaaagccacggccgatgccctggtcgacggcgggattgccgtg
gacctcgttccggaatcgcaggccaattcggaaggactgctggagacgcccccgatgcgg
gacgtcgcaggccggcggatcctcatcgtgcgcggcgagggcgggcgggaaacgctcaag
gaacggcttgtcgaacgtggggcactggtccagtatgccgagctgtaccggcgggtgccg
gtgcacacgggtgccgaagcactgatcgaaggcctgcggaccgccgggctcgacatgctg
accgccaccagcggcgaagccatcgagcatctgtaccgcctggttccacccgaggaccgg
ccgcggctggtcgagacgccgctggtcgtcatcagcgaacgattgaaaaatcaagccgga
tcgctgggtttccggcacgtgaaggtggccgacgccgcatcggatgccgccgtgctgcaa
gccctggaggatgtcgcagcccgtttggcatccttgcgagccgcgcccaacgacggggat
aagccattggccgaggaagaaaaacaaatgaccgaagcgccgcaatcaccggcagccggg
gaagtctcccgacacccgcacggcaacgctgccgcgcctccggtgcatccgccgcgcaga
tcgcgggtagtcgcctggctgggctactcgatgctggccgccattctgctgctggccacc
gccggctatttcctgatccaggaactgcgctccaagcaggagggtctgggcggcgagctc
aacaagggcgatctgcacttgctggaactcagccgccaggtcagcagcctgcagactcaa
ctcgccaccctccattcccagttcgccaccctccagtcccagctcgggacggaggacagc
aagctggagcgtctgctcggcgagcaatccgccagtttcggccagaggctcgaggacagc
cgcaaagaactgacgcggtccatcgagaccctccagcgtcaactaagccggacccacagc
gatgtcctgatcgcggatgccgaatatcttttgggcattgccaatcagaagctgcacctc
accggtgacgtgaaatccgtcctcgaagccatgaaggccgcggaccaaagactccgtgac
agcgacgaccccggcgtgttcaaggtgcgggaggtcttggcggaggaaatcaaccgactc
gaggccttccagccgcccgacgtggtcggactgtcggccaggctgctggcgattgaagcc
aagacgcgggagctgccgctgttcctgccacatcccgacatgtcgaaggaaccgcgcgag
acgtccaagcccaaatcaccggaacccgaaaccggcgatgccgtcgagtccaccctcgag
cagctcaagggactggtcaccgtgcgccgcagcgaccgccccgtgcatgccgtcctgact
ccccaggaggccgccggcctccgggaaatcctgctgctcaaactggagatgacccgcacc
tccctgttgcgcggcgacgatgcactgttccacagcaatctggaatccgcaaacgcctgg
ctgaacgaaaatttcgaccgcgagtcccccgccttcaaggacatctcggacgatctccgg
gccctggccggcgtccagctcaaggccgccttccccgacatcagcggatcactcgccttg
ctccgcaacatcgaaaaactgcggctcgaaaccgaccccgtcgcaccggcaagcacggcc
gcccccgccgggaatgaagcgccgggagacagaccgtga

DBGET integrated database retrieval system