KEGG   Mycobacterium chubuense: Mycch_0226Help
Entry
Mycch_0226        CDS       T02150                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mcb  Mycobacterium chubuense
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mcb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mcb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
222650..223870
Genome map
AA seq 406 aa AA seqDB search
MLPLGSEPMVVHRRVPSALIGVLTGAALLVGCTSNNHEPAGPPTTATPSMAAGPASNAPA
AGPVAPACGDPAAVVAAMSTRDKLAQLLMVGVTGSADARAVVDTQHVGGIMIGSWTDLSM
MSDNSLTGIAANAGPLPLAVSVDEEGGRVSRLAGLIGSQPAPRVLAQTRTPEEVYGIALD
RGKKMRALGVTIDFAPVADVTDAPDDTVIGDRSFSGDPVKVTDYAGAYARGLRDAGVLPV
LKHFPGHGHGDGDSHAGSVVTPPLSALQSNDLVPYRTLTTQAPVAVMVGHMEVPGLTGSD
PASLSPAAYALLRSGDYGGPPFNGLIFTDDLSSMRAITDRFGVADAVLRALQAGADVALW
VTTTEVPAVLDRLEKAVAAGELSMKHVDDAVTKLAAQKGPSPRCGR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccgttagggtcggaacccatggtcgtgcaccggagagttccgagtgctctgatc
ggggtgctcacgggggctgcgcttctggtcggatgcacgtcgaacaaccacgagcccgca
ggtcctccgaccactgccacgccgtcgatggcggccgggccggcgtcgaacgctccggcc
gcggggcccgtggccccggcctgcggtgacccggccgcggtcgtcgcggccatgtcgacg
cgcgacaagctcgcgcagctgctgatggtcggcgtgaccggctcggcggacgcccgcgcc
gtcgtcgacacccagcacgtcggcggcatcatgatcggcagctggaccgatctgtcgatg
atgtcggacaactcgctgaccggcatcgccgccaacgccgggccgctgcccttggccgtc
agcgtcgacgaggagggtggccgggtgtcgcggctggcggggctgatcggctcgcagccc
gcaccgcgggtgctcgcccagacccgcaccccggaagaggtctacgggatcgcgctcgat
cgcgggaagaagatgcgcgcgctcggggtcacgatcgacttcgctccggtggccgatgtc
accgacgcgcccgacgacaccgtcatcggtgaccggtcgttcagcggagaccccgtcaag
gtcaccgactacgccggcgcctacgcgcgcggcctccgcgacgccggggtgctgccggtg
ctcaagcacttcccgggtcacggccacggcgacggcgactcgcacgcgggcagtgtggtc
accccgccgctctccgctctgcagagcaacgatctggtgccctaccggacgctgaccacg
caggcgcccgtcgccgtcatggtcggccacatggaggtacccgggctgaccggcagcgac
cccgcgagcctgagcccggctgcgtacgcgctgctgaggtccggcgactacggcggcccg
ccgttcaacggactgatcttcaccgacgacctgtcgagcatgcgtgccatcaccgaccgc
ttcggcgtcgccgacgcggtgctgcgcgccctgcaggccggggccgacgtggcgctgtgg
gtcaccaccacggaggtgcccgcggtcctcgaccggctggagaaggccgtcgcggccggc
gagttgtcgatgaagcacgtggatgacgcggtcacgaaactggccgcccagaagggcccg
tcgccacgctgcggccgctga

DBGET integrated database retrieval system