KEGG   Mycobacterium chubuense: Mycch_0259Help
Entry
Mycch_0259        CDS       T02150                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mcb  Mycobacterium chubuense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mcb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(267756..268898)
Genome map
AA seq 380 aa AA seqDB search
MREPEWAPLTGFRVAVTSARRADELSALLRRRGAAVTSAAAIEMVPLPDDDELRLRTQAL
IDCPPDIVIATTGIGFRGWVAAADGWGMAASLTAALGTARIVSRGPKATGALRAAGLPEE
WSPESESSREVLHYLVEGGIAGTRIAVQLHGATAEWDPFPEFLDELRSAGAEVVPIRVYR
WHPAPRDGEFDALVMGIAEQKFDAVSFTSAPAVASVLMRAAEMGVDAEVLAALRNGVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQSRTVRVAGHLLEIRGTCVLV
DGTVKALSPAAMATIRALAHRPGAVVSRTDLLRALPGSGTDTHAVETAVLRLRTALGDKS
MVSTVVKRGYRLTVDEAFAS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagggagccggaatgggcgccgctcaccggattccgggtcgcggtcacatcagcgcga
cgcgccgacgagctcagcgcgctgctgcgtcgccggggtgcggccgtcaccagcgcggcc
gcgatcgagatggtgccgctgcccgatgacgacgagctgcgtctgcgcacgcaggcgctg
atcgactgtccgccggacatcgtcatcgcgaccacgggcatcggcttccgcggctgggtc
gcggcggctgacgggtggggcatggccgcttcgctgacggccgcgctcggcacggcgcgc
atcgtctcccgcggacccaaggcgaccggcgcactgcgcgcggccgggctgcccgaggag
tggtcaccggaatcggagtcctcgcgcgaggtgctgcactacctggtggaaggtggtatc
gccggaacccggatcgcggtgcagctgcacggagcgaccgcggaatgggatccgttccca
gagtttctcgacgaattgcgctcggcgggagcagaagtcgtcccgatccgggtttaccgc
tggcatccggcgcctcgcgacggcgagttcgacgccctggtcatggggatcgccgagcag
aagttcgacgcggtgagcttcacctccgcgccggccgtcgcgtcggtgctgatgcgggcc
gccgagatgggtgtcgacgccgaggtgctcgcggcgctgcgcaacggcgtgcacgcgatg
tgcgtgggaccggtcacggcgcggccgctggtgcggctcggcgtgccgacctcggcgccc
gagcgaatgcggttgggggcgttggcccgtcacatcaccgatgagctgccgctgctgcag
tcgcggacggtgcgcgtggccggccatctcctcgagatccgcggcacctgcgtgctggtc
gacggcaccgtcaaggccctctcacccgcggcgatggccaccatccgggcgctggcgcac
cgtcccggcgcggtggtctcgcgcaccgatctgcttcgcgcactgcccggcagcggcacc
gacacgcacgcggtcgagaccgcggtgctgcggctgcgaacggcgttgggcgacaagtcg
atggtgtccaccgtcgtcaaacggggctatcgcctgaccgtcgacgaggcgttcgcatcg
tga

DBGET integrated database retrieval system