KEGG   Mycobacterium chubuense: Mycch_0561Help
Entry
Mycch_0561        CDS       T02150                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00071  Fatty acid degradation
mcb00280  Valine, leucine and isoleucine degradation
mcb00281  Geraniol degradation
mcb00310  Lysine degradation
mcb00360  Phenylalanine metabolism
mcb00362  Benzoate degradation
mcb00380  Tryptophan metabolism
mcb00410  beta-Alanine metabolism
mcb00627  Aminobenzoate degradation
mcb00640  Propanoate metabolism
mcb00650  Butanoate metabolism
mcb00903  Limonene and pinene degradation
mcb00930  Caprolactam degradation
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01212  Fatty acid metabolism
Module
mcb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycch_0561
   00650 Butanoate metabolism
    Mycch_0561
  Lipid metabolism
   00071 Fatty acid degradation
    Mycch_0561
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycch_0561
   00310 Lysine degradation
    Mycch_0561
   00360 Phenylalanine metabolism
    Mycch_0561
   00380 Tryptophan metabolism
    Mycch_0561
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mycch_0561
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mycch_0561
   00281 Geraniol degradation
    Mycch_0561
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycch_0561
   00627 Aminobenzoate degradation
    Mycch_0561
   00930 Caprolactam degradation
    Mycch_0561
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mycch_0561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFM15379
UniProt: I4BDM2
Position
complement(580090..580986)
Genome map
AA seq 298 aa AA seqDB search
MPQFETVLYTAAPPVATITLNRPDRLNTIVPPMPDEIEAAIGLAERDPDVKVIVLRGAGR
AFSGGYDFGGGFSHWGEAMHTDGRWDPGKDFAMVSARETGPTQKFMAIWRASKPVIAQVH
GWCVGGASDYALCADLVIASDDAVIGTPYARMWGAYLTGMWLYRLSLAKVKWHSLTGEPL
TGKEAAAVELINESVPFERLEARVAEIAARLATIPLSQLQAQKLIVNQAYENMGLASTQT
LGGILDGLMRNTPDALRFIDVAADEGVRSAIERRDGPWNDYSQAPPERQPDPSHVIEP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagttcgagacagtcctgtacacggccgcgccgcccgtcgcgaccatcacgctg
aaccggccagaccggctgaacaccatcgtgccgccgatgcccgacgagatcgaggcggcg
atcgggctggccgaacgggatccggacgtcaaggtcatcgtgttgcgcggtgcgggccgc
gcgttttcgggcggatacgacttcggcggcgggttctcccactggggcgaggcgatgcac
accgacggccggtgggaccccggcaaggacttcgcgatggtctccgcccgcgagaccggg
cccacgcagaaattcatggcgatctggcgggcctccaagccggtcatcgcgcaggtgcac
ggctggtgcgtcggtggcgccagcgactacgcgctgtgcgccgacctcgtcatcgcgagc
gacgacgccgtgatcggcactccctatgcccgcatgtggggcgcctacctgaccgggatg
tggctctaccggctgtcgctggccaaggtgaagtggcattcgctcaccggcgaaccgctc
accggaaaagaagccgccgcagtcgaactcatcaacgagtcggttccgttcgagcgtctc
gaggcgcgcgtcgccgagatcgcggccaggctggcgaccattccgctctcgcagttgcag
gcgcagaagctcatcgtcaaccaggcctacgagaacatgggtctggcatcgacgcagaca
ctcggcgggatcctcgacgggctgatgcgcaacaccccggacgcgctgcgcttcatcgac
gtggcggccgacgaaggggtgcggtccgcgatcgagcgccgcgacggcccgtggaacgac
tacagccaggcgcctccggagcgacagcccgatccgtcgcacgtgatcgagccctag

DBGET integrated database retrieval system