KEGG   Mycobacterium chubuense: Mycch_0579Help
Entry
Mycch_0579        CDS       T02150                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00630  Glyoxylate and dicarboxylate metabolism
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mycch_0579
Enzymes [BR:mcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mycch_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFM15397
UniProt: I4BDP0
Position
597008..598300
Genome map
AA seq 430 aa AA seqDB search
MTKSTVGTPKSPEQIQHDWDHNPRWKGITREYTPADVVALQGTVVEEHTLARRGAEVLWE
QLHDMDFVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVP
QVVRRINNALLRADEIAKVEGDRSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAG
SHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLIT
SDVDERDQPFITGDRTAEGFYRVKNGLEPCIARAKAYAPYSDLIWMETGTPDLELAKKFA
EGVKSEFPDQMLAYNCSPSFNWRKHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSM
FDLAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTAL
AGSTEEGQFH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtcgaccgtcggcacgccgaagagccccgagcagatccagcacgactgggat
cacaacccgcgctggaagggcatcacccgcgagtacaccccggccgacgtggtggccctg
cagggcaccgtcgtcgaggagcacaccctggcccgccgcggcgccgaggtgctgtgggag
caactgcacgacatggacttcgtcaacgcgctcggtgcgctgaccggcaacatggcggtg
cagcaggtgcgcgcgggtctgaaggccatctacctgtcgggttggcaggtcgccggtgac
gcgaacctgtccggccacacctaccccgaccagagcctctacccggccaactcggtgccc
caggtggtgcgccgcatcaacaacgcgctgctgcgcgccgacgagatcgccaaggtcgag
ggcgaccgctcggtggagaactggctggccccgatcgtcgccgacggtgaggccggtttc
ggtggcgcactgaacgtctacgagctgcagaaggcgatgatcgccgccggtgtcgccggt
tcgcactgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtg
ctgatcccgacccagcagcacatccgcacgctgacctcggcccgtctggccgccgacgtc
gccgacgtgccgaccgtcgtcatcgcccgcaccgacgccgaggccgccacgctgatcacc
tcggacgtcgacgagcgcgaccagccgttcatcaccggcgaccgcaccgccgagggcttc
taccgggtgaagaacggcctcgagccctgcatcgcccgcgccaaggcctacgcgccgtac
tccgacctgatctggatggagaccggcaccccggacctcgagctcgcgaagaagttcgcc
gagggcgtcaagagcgagttcccggaccagatgctggcctacaactgctcgccgtcgttc
aactggcgcaagcacctcgacgacgcgacgatcgcgaagttccagaaggagctgggcgcg
atgggcttcaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatg
ttcgatctggcctacggctacgcccgcaaccagatgagcgcctacgtggagctgcaggag
cgcgagttcgccgccgaggagcgcggctacaccgccaccaagcaccagcgcgaggtcggc
gccggctacttcgaccggatcgccaccaccgtggatccgacgtcgtcgaccaccgcgctc
gccggctcgaccgaagagggccagttccactga

DBGET integrated database retrieval system