KEGG   Mycobacterium chubuense: Mycch_0579Help
Entry
Mycch_0579        CDS       T02150                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mcb  Mycobacterium chubuense
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_0579
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mycch_0579
Enzymes [BR:mcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mycch_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
597008..598300
Genome map
AA seq 430 aa AA seqDB search
MTKSTVGTPKSPEQIQHDWDHNPRWKGITREYTPADVVALQGTVVEEHTLARRGAEVLWE
QLHDMDFVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVP
QVVRRINNALLRADEIAKVEGDRSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAG
SHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLIT
SDVDERDQPFITGDRTAEGFYRVKNGLEPCIARAKAYAPYSDLIWMETGTPDLELAKKFA
EGVKSEFPDQMLAYNCSPSFNWRKHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSM
FDLAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTAL
AGSTEEGQFH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtcgaccgtcggcacgccgaagagccccgagcagatccagcacgactgggat
cacaacccgcgctggaagggcatcacccgcgagtacaccccggccgacgtggtggccctg
cagggcaccgtcgtcgaggagcacaccctggcccgccgcggcgccgaggtgctgtgggag
caactgcacgacatggacttcgtcaacgcgctcggtgcgctgaccggcaacatggcggtg
cagcaggtgcgcgcgggtctgaaggccatctacctgtcgggttggcaggtcgccggtgac
gcgaacctgtccggccacacctaccccgaccagagcctctacccggccaactcggtgccc
caggtggtgcgccgcatcaacaacgcgctgctgcgcgccgacgagatcgccaaggtcgag
ggcgaccgctcggtggagaactggctggccccgatcgtcgccgacggtgaggccggtttc
ggtggcgcactgaacgtctacgagctgcagaaggcgatgatcgccgccggtgtcgccggt
tcgcactgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtg
ctgatcccgacccagcagcacatccgcacgctgacctcggcccgtctggccgccgacgtc
gccgacgtgccgaccgtcgtcatcgcccgcaccgacgccgaggccgccacgctgatcacc
tcggacgtcgacgagcgcgaccagccgttcatcaccggcgaccgcaccgccgagggcttc
taccgggtgaagaacggcctcgagccctgcatcgcccgcgccaaggcctacgcgccgtac
tccgacctgatctggatggagaccggcaccccggacctcgagctcgcgaagaagttcgcc
gagggcgtcaagagcgagttcccggaccagatgctggcctacaactgctcgccgtcgttc
aactggcgcaagcacctcgacgacgcgacgatcgcgaagttccagaaggagctgggcgcg
atgggcttcaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatg
ttcgatctggcctacggctacgcccgcaaccagatgagcgcctacgtggagctgcaggag
cgcgagttcgccgccgaggagcgcggctacaccgccaccaagcaccagcgcgaggtcggc
gccggctacttcgaccggatcgccaccaccgtggatccgacgtcgtcgaccaccgcgctc
gccggctcgaccgaagagggccagttccactga

DBGET integrated database retrieval system