KEGG   Mycobacterium chubuense: Mycch_0602Help
Entry
Mycch_0602        CDS       T02150                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_0602
   01230 Biosynthesis of amino acids
    Mycch_0602
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_0602
  Energy metabolism
   00680 Methane metabolism
    Mycch_0602
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycch_0602
Enzymes [BR:mcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mycch_0602
Exosome [BR:mcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mycch_0602
  Exosomal proteins of melanoma cells
   Mycch_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616938..617690
Genome map
AA seq 250 aa AA seqDB search
MADTATLILLRHGESEWNALNLFTGWVDVDLTDKGRAEAARAGELLKDQDRLPDVLYTSL
LRRAITTANVALDKADRHWIPVHRDWRLNERHYGALQGLDKAETKAKYGDEQFMAWRRSY
DTPPPPIEVGSRYSQDADPRYADIPGGPPLTECLKDVVERFVPYYTEAIVPDLVAGKTVL
IAAHGNSLRALVKYLDGMSDDDVVGLNIPTGIPLRYDLDAELKPTVPGGTYLDPEAAAAG
AAAVAAQGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgataccgcgacgctgatcctgctccgccatggcgaaagtgagtggaacgcgctg
aacctgttcaccggatgggtcgacgtcgacctcaccgacaaggggagggcggaagcggcc
cgagccggcgagctcctcaaggaccaggaccggctgccggacgtgctgtacacctcgctg
ttgcggcgcgccatcaccaccgccaacgtcgcgttggacaaggccgaccggcactggatc
cccgtgcaccgcgactggcggctcaacgagcggcactacggcgcgctgcagggcctcgac
aaggccgagaccaaggccaagtacggcgacgagcagttcatggcctggcggcgcagctac
gacaccccgcccccgccgatcgaggtcggcagccggtacagccaggatgccgacccccgc
tacgccgacatccccggcggcccgccgctgacggaatgcctcaaagacgtcgtcgagcgg
ttcgtgccgtactacaccgaggcgatcgtgcccgacctggtcgccggcaagaccgtgctg
atcgcggcgcacggcaactcgctgcgcgcgctggtgaagtacctcgacggcatgtccgac
gacgacgtcgtcgggctgaacatcccgaccggtatcccgttgcgctacgacctggacgcc
gagctcaagccgacggtgccgggcgggacgtacctggatcccgaggccgccgcggccggt
gcggcggcggtggccgcccagggtgccaagtag

DBGET integrated database retrieval system