KEGG   Mycobacterium chubuense: Mycch_0602Help
Entry
Mycch_0602        CDS       T02150                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00010  Glycolysis / Gluconeogenesis
mcb00260  Glycine, serine and threonine metabolism
mcb00680  Methane metabolism
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
mcb01230  Biosynthesis of amino acids
Module
mcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcb_M00002  Glycolysis, core module involving three-carbon compounds
mcb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_0602
  Energy metabolism
   00680 Methane metabolism
    Mycch_0602
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycch_0602
Enzymes [BR:mcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mycch_0602
Membrane trafficking [BR:mcb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mycch_0602
Exosome [BR:mcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mycch_0602
  Exosomal proteins of melanoma cells
   Mycch_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFM15420
UniProt: I4BDR3
Position
616938..617690
Genome map
AA seq 250 aa AA seqDB search
MADTATLILLRHGESEWNALNLFTGWVDVDLTDKGRAEAARAGELLKDQDRLPDVLYTSL
LRRAITTANVALDKADRHWIPVHRDWRLNERHYGALQGLDKAETKAKYGDEQFMAWRRSY
DTPPPPIEVGSRYSQDADPRYADIPGGPPLTECLKDVVERFVPYYTEAIVPDLVAGKTVL
IAAHGNSLRALVKYLDGMSDDDVVGLNIPTGIPLRYDLDAELKPTVPGGTYLDPEAAAAG
AAAVAAQGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgataccgcgacgctgatcctgctccgccatggcgaaagtgagtggaacgcgctg
aacctgttcaccggatgggtcgacgtcgacctcaccgacaaggggagggcggaagcggcc
cgagccggcgagctcctcaaggaccaggaccggctgccggacgtgctgtacacctcgctg
ttgcggcgcgccatcaccaccgccaacgtcgcgttggacaaggccgaccggcactggatc
cccgtgcaccgcgactggcggctcaacgagcggcactacggcgcgctgcagggcctcgac
aaggccgagaccaaggccaagtacggcgacgagcagttcatggcctggcggcgcagctac
gacaccccgcccccgccgatcgaggtcggcagccggtacagccaggatgccgacccccgc
tacgccgacatccccggcggcccgccgctgacggaatgcctcaaagacgtcgtcgagcgg
ttcgtgccgtactacaccgaggcgatcgtgcccgacctggtcgccggcaagaccgtgctg
atcgcggcgcacggcaactcgctgcgcgcgctggtgaagtacctcgacggcatgtccgac
gacgacgtcgtcgggctgaacatcccgaccggtatcccgttgcgctacgacctggacgcc
gagctcaagccgacggtgccgggcgggacgtacctggatcccgaggccgccgcggccggt
gcggcggcggtggccgcccagggtgccaagtag

DBGET integrated database retrieval system