KEGG   Mycobacterium chubuense: Mycch_0622Help
Entry
Mycch_0622        CDS       T02150                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mcb  Mycobacterium chubuense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mycch_0622
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mycch_0622
Exosome [BR:mcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mycch_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634812..635792
Genome map
AA seq 326 aa AA seqDB search
MPFPGHRPRRLRTTPAMRRLVAETSLEPRHLVLPMFVADGIAEPREIGSMPGVVQHTRDS
LRRAADDAVRAGVGGLMLFGIPREDDKDPLGSAGVDPDGILNVALRDLAADLGDATVLMA
DTCLDEFTDHGHCGIVDADGRVDNDATNHRYVELAVAQANAGAHVVSPSGMMDGQVAAIR
NGLDAEGLTDTAVLAYAAKFASGFYGPFREAVASSLQGDRRTYQQNPGNAREAIHEVDLD
VDEGADIIMVKPAMAYLDVLRAAADVSPVPVAAYQVSGEYSMISAAAAHGWIDLKTVVLE
TLTGIRRAGGDIVLTYWAVDVARWLS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccctttccgggtcaccgtccacggaggctgcgcaccaccccggccatgcgccggctg
gtagccgagacatcgctggagccacggcatctcgtgttgccgatgttcgtggccgacggc
atcgccgaaccgcgcgagatcgggtcgatgcccggtgtcgtgcagcacaccagggattcg
ctgcgccgcgcggctgacgacgccgtccgggcgggcgtgggcgggttgatgcttttcggc
atcccccgggaggacgacaaggacccgctgggatcggccggtgtcgacccggacggaatc
ctcaacgtcgcgctgcgggacctggccgccgacctcggcgatgccacggtgctgatggcc
gacacctgcctcgacgagttcaccgaccacggccactgcgggatcgtcgacgccgacggc
cgggtcgacaacgacgcgaccaaccaccggtatgtggaactcgctgtcgcacaagcgaat
gcgggtgcgcacgtggtgagcccgagcgggatgatggacggtcaggtcgccgcgatccgc
aacgggctcgacgccgaggggctcaccgacaccgccgtcctggcctacgcggcgaagttc
gcctcgggcttctacggcccgttccgtgaggccgtggcgtccagcctgcagggcgaccgg
cgcacgtaccagcagaatccgggcaacgcccgcgaggcgatccacgaggtggacctcgac
gtcgacgaaggcgccgacatcatcatggtcaagcctgcgatggcctacctcgacgtgctc
cgcgccgccgccgacgtctcgccggttccggttgcggcgtaccaggtttcgggcgagtac
tcgatgatcagcgcggcggccgcccacggctggatcgacctgaagaccgtggtgctcgag
acgttgaccggcatccggcgcgccggcggcgacatcgtgctgacctactgggccgtcgac
gtggcccggtggctgtcgtga

DBGET integrated database retrieval system