KEGG   Mycobacterium chubuense: Mycch_0896Help
Entry
Mycch_0896        CDS       T02150                                 

Definition
transcriptional regulator/sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_0896
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_0896
   00052 Galactose metabolism
    Mycch_0896
   00500 Starch and sucrose metabolism
    Mycch_0896
   00520 Amino sugar and nucleotide sugar metabolism
    Mycch_0896
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mycch_0896
   00524 Butirosin and neomycin biosynthesis
    Mycch_0896
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mycch_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907112..908020
Genome map
AA seq 302 aa AA seqDB search
MSDHILALDIGGTKIAAGLVDPDGTLVHRAQLPTPDGDAETVWRAVASLVEQTLALTDRK
VTGVGVGTAGPIDVPGGTVSPINIAEWRHFPIVEHVAQLTGLPVRLGGDGLCMAMGEWWR
GAGRDSRFMLGMVISTGIGGGLVLDGAPYHGRTGNAGHVGHVVVEPGGAPCTCGGRGCVE
TVASGPHLAQWALANGWQGPPGADARELAEAAERGDPVARRAFDRGADAVARMIASVAAV
ADLDLVVVGGGVAKAGPVLFDPLREALGTYAGLDFLHNLRVVTAELGGDAGLVGAAALGR
FG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccacatcctcgcgctggacatcggtggcacgaagatcgccgccggactggtc
gaccccgacggcacgctcgtgcaccgggcgcagctgccgacgcccgacggtgacgccgag
acggtgtggcgcgccgtcgcgtcgctcgtcgagcagacgctcgccctgaccgaccggaag
gtgaccggggtgggcgtcgggacggccgggccgatcgacgtgcccggcggaaccgtcagc
cccatcaacatcgccgaatggcggcacttcccgatcgtcgagcacgtcgcgcagctgacg
ggtctgccggtgcgcctcggtggggacgggctgtgcatggcgatgggagagtggtggcgc
ggggccggccgggattcccgcttcatgctcggcatggtgatctcgacgggcatcggcggc
ggtctggtgctcgacggagcgccgtaccacggccgcaccggcaacgccggccacgtcggg
cacgtcgtcgtcgaaccgggcggtgcgccctgcacgtgtggagggcgcgggtgcgtcgag
accgtcgcgtcgggcccgcacctggcgcagtgggcgctggccaacgggtggcagggcccg
ccgggcgccgacgccagggaactggccgaagccgccgaacgcggcgacccggtggcgcgg
cgagcgttcgaccggggcgcggacgccgtcgcgaggatgatcgcctcggtggccgcagtc
gccgacctggacctggtggtcgtcgggggcggcgtggcgaaggccggtccggtgctgttc
gacccgctgcgcgaggcgctgggaacgtacgcgggcctggacttcctccacaacctgcgg
gtggtcaccgccgaactcggcggcgatgcgggcctcgtgggtgcggccgcactgggacgt
tttggctga

DBGET integrated database retrieval system