KEGG   Mycobacterium chubuense: Mycch_0990Help
Entry
Mycch_0990        CDS       T02150                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mcb  Mycobacterium chubuense
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:mcb00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:mcb00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(996551..997159)
Genome map
AA seq 202 aa AA seqDB search
MNVRELGVPGAWEITPRMHPDSRGLFFEWFTESGFAEFAGHRFRLAQANCSVSSAGVLRG
LHFAQLPPSQAKYVTCVTGAVFDVVVDIRVGSPTFGRWDAVTLDSSSRRTVYLSEGLAHG
FVALEDDSTVMYLCSEGYSPTREHTINALDPALGITWPVADVHLSDRDRAAPSLAEARAE
GLLPTWEDAQAFAEQLRRRSEG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccgcgagttgggggtgccgggcgcctgggagataaccccacggatgcacccg
gactcgcgggggctgttcttcgagtggttcaccgagtcggggttcgccgagttcgccggc
caccgattccggctcgcccaggcgaactgttcggtgtcctcggccggcgtgctgcgggga
ctgcatttcgcgcagctgccgccgagccaggcgaagtacgtcacgtgcgtgaccggggcg
gtcttcgatgtggtggtcgacatccgcgtcggctcgccgacgttcgggcggtgggacgcc
gtgacgctcgacagcagcagccgccgcacggtgtatctgtcggagggtctggcccacgga
ttcgttgcgctggaggacgattcgacggtgatgtacctgtgcagcgagggctactccccg
acgcgggaacatacgatcaacgcgctcgatcccgcgttgggaatcacgtggccagtcgct
gacgtgcacctgtcggatcgcgaccgcgcggcccccagcctggccgaagctcgagccgag
gggctcctgcccacgtgggaagacgcgcaggccttcgcggagcagctccgacgccgctcg
gaaggctag

DBGET integrated database retrieval system