KEGG   Mycobacterium chubuense: Mycch_1015Help
Entry
Mycch_1015        CDS       T02150                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_1015
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_1015
   00020 Citrate cycle (TCA cycle)
    Mycch_1015
   00620 Pyruvate metabolism
    Mycch_1015
Enzymes [BR:mcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mycch_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1019174..1020463
Genome map
AA seq 429 aa AA seqDB search
MPALGSDMDEGTLNEWLVKPGDTVTRGQIVAVVETTKAAVEIECWHDGVVAELLVPVGQT
VSVGTPLAMLAESGEEVTAAPPAPQPVAAPAPVAVAPAAVAPTVSAPPAPAVPAPAFAAP
AAPGHRRWVSPAARRLAASSGVDLDAVTGTGPQGAVTLSDVEHAATGQPAVTTPTPPAVT
VPEPAVTRPAPEAIAKPAATSRTPAERAAEMRKSIAAAMSRSKREIPHYYLAHEIMMHTA
LSWLAERNSTRSVTERVLPAVLQIKAVALAAQRYAEFNGFWRQDGFEPAEGVHVGVAISL
RGGGLVAPAIHDVPKRGLDELMADLTDLVARARAGSLRSSEMSDPTITVTNMGDQGVDAV
FGVIYPQQVAIVGFGKPADRVCVIDSGIRVVPTVQATLSGDHRASDGHRGGLFLSAVNEL
LTDPQLLED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgctcggctccgacatggacgagggcacgctgaacgagtggctcgtcaagccg
ggcgacaccgtgacccgcgggcagatcgtcgcggtcgtcgaaaccaccaaagccgcagtg
gaaatcgaatgctggcacgacggcgtcgtcgcggagctgctggtcccggtcggccagacg
gtctcggtggggacgcccctggcgatgctggccgaatccggcgaagaggtcaccgccgct
ccgccggccccgcagcccgtcgcggcaccggctccggtggcggtcgcacctgctgccgtg
gctccgaccgtctcggcccctccggccccggccgtcccagcgccggctttcgcagcgccg
gcggctccgggccaccgccgctgggtgtctccggccgcgcgccgcctggccgcatcgtcc
ggtgtggacctcgacgccgtcaccggcaccggtccgcagggggcggtgacgttgagcgac
gtcgagcacgcggcgacggggcaaccggcggtcacgacgccgacccctcccgccgtcacg
gtgccggaaccggcggtcacgaggccggcgccggaggcgatcgcgaaacccgccgcgacg
agccgcacccccgccgagcgcgccgcggagatgcggaagtcgatcgccgccgcgatgagc
cggtccaagcgcgagatcccgcactactacctcgcgcacgagatcatgatgcacacggcg
ctgtcctggctggccgagcggaactccacccgctcggtcaccgagcgggtattgccggcc
gtcctgcagatcaaggcggtagcgcttgccgcgcaacgttatgcggagttcaacgggttc
tggcggcaggacggcttcgagcccgcggagggcgtgcacgtcggtgtcgccatctccctg
cgtggaggcgggctggtggcgccggccatccacgacgtccccaagcgcggactcgacgaa
ctgatggccgacctcaccgatctggtggcacgtgcccgcgccggctcactgcgcagctcg
gagatgtccgaccccaccatcacggtcaccaacatgggcgaccaaggagtggacgcggtg
ttcggagtcatctacccgcagcaggtggcgatcgtcggtttcggtaaaccggccgaccgg
gtctgcgtgatcgacagcggcatccgcgtcgtgccgaccgtgcaggcgaccctgtccggc
gatcaccgcgccagcgacggccaccgtggcggactgttcctctctgccgtcaacgaactg
ctgaccgacccgcaactcctggaggactga

DBGET integrated database retrieval system