KEGG   Mycobacterium chubuense: Mycch_1117Help
Entry
Mycch_1117        CDS       T02150                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mcb  Mycobacterium chubuense
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mcb00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115429..1117195
Genome map
AA seq 588 aa AA seqDB search
MKPDYDVVIIGSGFGGSVSALRLTEKGYRVLVLEAGKRYADPDFAKTSWNLRRFLWAPRF
GMFGIQRIHLLNNVMILAGAGVGGGSLNYANTLYVPREPFFNDPQWRDITDWRAELLPHY
DQAQRMLGVVTNPTVTDADRIMQEVAEDMGCRDTWVPTPVGVFFGPDGEKTPGKTVPDPY
FGGAGPERTGCIECGACMTGCRYGAKNTLVKNYLGLAERAGATVRPMTTVTDFSQRPDGT
WEIRTVRTGSWVRRTRRTFTANQVVLAAGTYGTQRLLFKMRDTGRLPKLSDRLGMLTRTN
SESIVGAGRLRVTDDLNLTHGVAITSSIHPTSDTHVEPCRYGKGSNAMGLLQTLMTDGAG
PEGTDVPRWRQLVQIAREDPKGTLRLLNPRRWSERTMIALVMQNLDNSITTFTKRTRFGF
RRYLSKQGHGEPNPSWIPVGNEVTRRIAKKIDGVAGGTWGELFNIPLTAHFLGGAVIGES
RETGVIDPYHRVYDYPTLSVVDGAAISANLGVNPSLSITAQAERAASLWPNKGEEDLRPA
QGQPYRRLDPIEPARPVVPAGAPAALDWGVSAETVNRRDPTTAEAQGA
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgactatgacgtggtcatcatcggttcgggattcggcggcagcgtcagcgcg
ctgcgactcaccgagaagggctatcgggtcctggtgctggaggccggcaagcgctacgcc
gaccccgacttcgccaagacctcgtggaacctgcgcaggttcctgtgggcgccgcggttc
ggcatgttcggcatccagcgcatccacctgctcaacaacgtcatgatcctggcgggcgcc
ggggtcggcggtggctcactgaactacgcgaacacgctctatgtgccgagggagccgttc
ttcaacgacccgcagtggcgcgacatcaccgactggcgtgccgagctgctgccgcactac
gaccaggcgcagcggatgctcggggtggtcaccaacccgacggtcaccgatgccgaccgg
atcatgcaggaggtcgccgaggacatgggctgccgcgacacctgggtgccgacgccggtc
ggggtgttcttcgggcccgacggcgagaagacgccgggcaagaccgttcccgatccgtac
ttcggcggcgccggtccggagcgcaccgggtgcatcgagtgcggagcgtgcatgacgggc
tgccgctacggcgccaagaacaccctggtgaagaactacctcgggctggccgagcgggcc
ggcgccacggtgcgcccgatgaccacggtgaccgatttctcgcagcgccccgacggcacg
tgggagatccgcaccgtgcggacaggaagctgggtgcgccggacccgccgcaccttcacc
gcgaaccaggtggtgctggccgcgggcacctacggcacccagcggttgctgttcaagatg
cgcgataccggccggctgcccaaactctccgaccggctcggcatgctcacgcgcacgaac
tccgagtcgatcgtcggggccggccggttgcgcgtcaccgacgacttgaatctcacccac
ggcgtggcgatcacctcgtcgatccaccccacctccgacacccacgtcgagccgtgccgg
tacggcaagggttcgaacgcgatggggctgctgcagacgctgatgaccgacggcgccggt
ccggagggcaccgacgtaccgcggtggcggcagctggtgcagatcgcccgcgaggacccc
aagggcaccctgcggctgctcaacccgcggcgctggagtgagcgcacgatgatcgccctg
gtcatgcagaatctagacaactcgatcacgacgttcaccaagcgcacccggttcgggttc
cgccgctatctgagcaagcagggccacggcgagccgaacccgtcgtggatcccggtgggc
aacgaggtcacccgccgcatcgcgaagaagatcgacggcgtcgccggcggcacgtggggc
gagctgttcaacatccccctcaccgcgcacttcctcggcggtgcggtcatcggtgagagc
cgcgagaccggcgtcatcgacccgtaccaccgggtgtacgactacccgacgctgtcggtg
gtcgacggcgcggcgatctcggcgaatctcggtgtgaacccgtcgctttcgatcaccgcg
caggccgagcgggccgcctcgctgtggccgaacaagggcgaggaggacctgcgtccggcg
caggggcagccctaccggcggctggaccccatcgagccggcgcggccggtggtgcccgcg
ggtgcgcccgcggccctggactggggggtgagcgccgagacggtcaaccggcgggatccc
accaccgccgaggcgcagggcgcctga

DBGET integrated database retrieval system