KEGG   Mycobacterium chubuense: Mycch_1189Help
Entry
Mycch_1189        CDS       T02150                                 

Definition
alcohol dehydrogenase, class IV (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mycch_1189
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_1189
   00620 Pyruvate metabolism
    Mycch_1189
   00650 Butanoate metabolism
    Mycch_1189
  Lipid metabolism
   00071 Fatty acid degradation
    Mycch_1189
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mycch_1189
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycch_1189
   00626 Naphthalene degradation
    Mycch_1189
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mycch_1189
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mycch_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195372..1198011
Genome map
AA seq 879 aa AA seqDB search
MTRTHSTHHVTTDAPEATRTQEVDAIVDAAAGAAREFRKLDQAQVDAIVEAMVRAGLRSA
AELAAVAISETGFGVFEDKVVKNYVATEFLHDYLRDKKSVGLIDEDIENNIRYVAEPIGV
VLAITPVTNPTSTVLFKAIVAAKTRNAIVFRPSPYAVRCCERSVEILREAAEAAGMPPGA
LQVIPDAAHEVTHYLFTHPKVDFVWVTGGPKIVALANASGKPGISVGPGNAPIYLHKTAD
IKGAVVDILISKTFDSSVICPAEQTCVIDDEIYDEVIAEFERMGARLLTGEEADKIAQFA
FGCGDKVALDAVGQKASELAARAGFTVSPTTKVLLAPLPSDLDALAAHPLVAEKLMPVLG
VVRARSVQHGIDVAVLVTEHGGLGHTSAIYANDEDVVDAYSLAVRTGRILVNAPTAVGAL
GGIYNNLTPTFSLGCGTWGGSSTTENVNYRQLLNIKTVAHRRTPPQWFRVPSNTYFNEGA
LDNLRDLDAEIAVVVTDALTEERGVVDQLRSRLPAHHVHVFSEVTPEPDESVIRDGVALL
ERAEPAVLIAVGGGSVLDAAKAMRLFYEHPEKSLDELTMPFLDPRKRVADFPTDHHRLQL
VAIPTTSGTGSEVSPAAVLTVGGRKETLVDYSLVPDLAIVDPVLTSSMPPALTADTGVDA
LTHALEAVISIFASSYTDALCAQAIRLIFSALPRAYADPGDMSARTDMSNAATLAGLAFS
NAFVGTNHALAHAVGAKFKIAHGRANGIFLPHVLRYNCSLPTKFMPAPGYSAYVVPEKYA
QIGQLVFGGHEPEDSRQRLFHAVEDLLDRLDMPRSLAEYGIGEDEFLAALPELAMTAFED
LSNRTNPRMPLVSEITTLLRQGYYGSAEPPADAGAEPTS
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcacgcacagcacacatcacgtgacgaccgacgcgcccgaggcgacgcggacg
caggaggtcgacgcgatcgtcgacgccgcggccggcgcggcccgggagttccgcaagctg
gaccaggcgcaggtcgacgcgatcgtggaggcgatggtgcgggccgggctccggtcggcc
gccgagctggccgcggtcgccatctccgagaccggcttcggggtgttcgaggacaaggtc
gtcaagaactacgtcgccaccgaattcctgcatgactacctgcgggacaagaagtcggtc
ggcctgatcgacgaggacatcgagaacaacatccgctacgtcgccgagccgatcggggtg
gtgttggcgatcaccccggtgaccaacccgacgtcgacggtgttgttcaaggcgatcgtg
gccgccaagacccgcaatgcgatcgtgttccgtccctcgccgtacgccgtgcgctgctgc
gagcgcagcgtcgagatcctgcgggaagccgcggaggcggccgggatgccgccgggtgcg
ctgcaggtgattcccgacgcggcacacgaggtgacccactacctcttcacgcatccgaag
gtcgacttcgtctgggtgacaggcggaccgaagatcgtggcgctggccaacgcgtccggc
aagccgggaatcagcgtcggcccgggcaatgccccgatctatctccacaagaccgcagac
atcaaaggcgccgtcgtcgacatcctcatctcgaagacgttcgattcgtcggtgatctgc
ccggccgagcagacctgcgtcatcgacgacgagatctacgacgaggtgatcgccgagttc
gaacgcatgggagcccggctgctcaccggcgaggaggccgacaagatcgcccaattcgcc
tttggctgcggcgacaaggtggccctggacgcggtggggcagaaggcgtcggagctcgcg
gcccgcgccggattcacggtctcgccgaccaccaaggtgctgttggctccgctgccgtcg
gacctcgacgcgctggcggcccatccgctggtggccgagaagctgatgccggtgctcggg
gtggtgcgggcgcgcagcgtgcagcacggcatcgacgtggccgtgctggtcaccgagcac
ggcgggctgggccacacgtcggcgatctacgccaacgacgaagacgtcgtcgacgcctac
agcctcgcggtgcgcaccgggcggatcctggtgaacgcgcccaccgccgtcggcgccctc
ggcggcatctacaacaacctgacgccgacgttctcgctggggtgcggcacctggggcggc
tcgagcaccaccgagaacgtcaactaccgccagctgctcaacatcaagaccgtggcgcac
cggcgcacccctccgcagtggttccgggtgccgtcgaacacctacttcaacgaaggcgcc
ctggacaatctgcgcgacctggacgccgagatcgcggtggtggtcaccgacgcgctgacc
gaggagcgcggagtcgtcgaccagctgcgcagcagactgcccgcccaccatgtgcacgtg
ttcagcgaggtgacgccggaacccgacgagtcggtcatccgggacggcgtcgcgctgctg
gagcgagccgaacccgcagtgctgatcgccgtgggagggggatcggtgctggacgccgcg
aaggcgatgcggttgttctacgagcacccggagaagagcctggacgagctgacgatgccg
ttcctggatccgcgcaagcgggtggccgacttcccgaccgaccaccaccggctccaattg
gtcgccatcccaacgacttccggtaccggatccgaagtgtctccggcggcggtgctgacg
gtcggcggccgcaaggagacactcgtcgactacagcctggtgccggacctggccatcgtg
gatccggtattgacgtcgtcgatgccgcccgcgctgaccgccgacaccggcgtcgacgcg
ctgacccacgcgctggaagcggtgatctccatcttcgcgtcgtcctacacggacgcgttg
tgcgcgcaggccattcggctgatcttctccgcgttgccccgggcgtacgccgatcccggc
gacatgtcggcgcgcaccgatatgtccaacgccgcgaccctcgccgggctggcgttctcg
aacgcgttcgtcggcaccaaccatgcgctggcgcacgccgtcggagcgaagttcaagatc
gcgcacggccgggcgaacggcatcttcctgcctcacgtcctgcgctacaactgcagtctg
ccaaccaaattcatgcccgcgcccggctactcggcctacgtggtgcccgagaaatacgcg
cagatcgggcaactcgtcttcggcggccacgagccggaggacagccggcagcggttgttc
cacgccgtcgaggacctgctcgaccggctcgacatgccccgctcgctcgccgagtacggc
atcggcgaggacgagttcctcgcggcgctgcccgaactcgcgatgacggcgttcgaggac
ctcagcaatcgcaccaacccgcggatgccgctggtcagcgagatcaccacgctgctgcgg
cagggctactacggaagtgccgagccgcccgccgacgccggtgccgagccgacgtcgtga

DBGET integrated database retrieval system