KEGG   Mycobacterium chubuense: Mycch_1199Help
Entry
Mycch_1199        CDS       T02150                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mcb  Mycobacterium chubuense
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:mcb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mcb00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mcb00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mcb00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1218750..1219238)
Genome map
AA seq 162 aa AA seqDB search
MTSTMRGENPYDHIGDRGGPAPVMQRSHDRPASLDNPRAPRRAGGMPNFEKYAWLFMRFS
GIVLVFLALGHLFIMLMWDNGVYRIDFNYVAQRWSSPFWQTWDLVLLWLAQLHGGNGLRT
IIADYSRKGSTKFWLNTLLALSMVFTLVLGTYVLLTFNANIS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcgacaatgcggggcgagaacccctacgaccacatcggcgaccgcggcgggccc
gcgcccgtcatgcagcgcagccacgaccggcccgccagcctcgacaatccgcgcgcgccc
cgccgcgccggcggcatgccgaacttcgagaagtacgcgtggctgttcatgcgcttctcc
ggcatcgtcctggtgttcctcgcgctcggacacctgttcatcatgctgatgtgggacaac
ggggtgtaccgcatcgacttcaactacgtcgcgcagcggtggtcatcgccgttctggcag
acctgggacctggtgttgctgtggctggctcagctgcacggcggcaacggcctgcgcacg
atcatcgccgactacagccgcaagggctccacgaagttctggctgaacacgctgctggcg
ctgtcgatggtgttcacgctggtgctgggcacctacgtgttgctgacgttcaacgcgaac
atctcttga

DBGET integrated database retrieval system