KEGG   Mycobacterium chubuense: Mycch_1202Help
Entry
Mycch_1202        CDS       T02150                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mcb  Mycobacterium chubuense
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mycch_1202
Enzymes [BR:mcb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mycch_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220299..1221636
Genome map
AA seq 445 aa AA seqDB search
MTQATFGAPEPMSHLDAPSVIRTKRDGGVLSDDVIDWVIDGYTHDRIGDGQMAALLMAIF
LRGMTRAEIARWTAAMVASGERFDFSDLRRAGRPLALVDKHSTGGVGDKITIPLVPVVMA
CGGAVPQAAGRGLGHTGGTLDKLESIPGFTAELTKQQIRQQLCDIGAAIFAAGELAPADR
KIYALRDVTGTTESLPLIASSVMSKKIAEGTRALVLDTKVGSGAFLATEAEARELARTMV
DLGAEHGLPTRAVLTDMEVPLGRTVGNAVEVVESLEVLEGGGPADVVELTLALAGEMLDL
AGLDGVDPAETLGDGTAMDAFRALVGAQGGDVAALSAEALPLGSHTETVRASGSGTMGDI
DAMAVGLAVWRLGAGRSEPGQRVQSGAGLRIHRRPGEPVAPGEPLFTLYTDTPERLGAAL
SELDGAYRIATEPPAQRPLIIDRIT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaggccacattcggcgcacctgagcccatgtcgcatctcgatgctccgtccgtc
atccggaccaagcgcgacggcggcgtgctgtccgacgacgtgatcgactgggtgatcgac
ggctacacccatgaccggatcggcgacggtcagatggccgcgctgctgatggcgatcttc
ctgcgcgggatgacccgtgccgagatcgcccgctggacggcggccatggtggcctcgggc
gagcggttcgatttcagcgacctgcgccgggccgggcgtccgcttgcgttggtggacaag
cactccacgggcggggtgggcgacaagatcaccatcccgctggtgccggtggtgatggcg
tgcggaggcgccgtcccgcaggccgcggggcgcgggctcggccataccggcggcaccctc
gacaaactcgagtccatccccggcttcaccgccgaactgaccaaacagcagatccgtcaa
caactttgcgatatcggcgcggcgatcttcgccgccggcgagctcgccccggccgaccgc
aagatctacgcactgcgcgacgtcaccggcaccaccgagtcgctgccgctgatcgcgagt
tcggtgatgagcaagaagatcgccgagggcacccgcgcgctggtgctcgacaccaaggtc
ggctcgggcgccttcctggccaccgaggccgaggccagggagctggcccgcacgatggtc
gacctgggcgccgaacacggcctgccgacccgcgcggtgctcaccgacatggaggtgccg
ctgggccgcacggtcggcaacgccgtcgaggtcgtcgagtcgctcgaggtgctcgaaggc
ggcggccccgccgacgtggtggagctgacgctggcgctggcgggggagatgctcgacctc
gcgggcctcgacggggtggacccggcggagacgctgggtgacggcaccgccatggacgcg
ttccgcgcgctggtcggcgcgcagggcggcgacgtcgcggcgctgtcggccgaggcgctg
ccgctcggatcgcacaccgagaccgtcagggcgtcgggaagtggcacgatgggcgacatc
gacgcgatggccgtgggattggcggtgtggcgactcggggcgggccgctccgagccggga
cagcgcgtgcagtcgggcgcgggcctgcgcatccaccgccgtcccggcgagcccgtcgcg
cccggtgagccgttgttcaccctctacaccgacaccccggagcggctcggcgcggcactg
tccgagctcgacggggcgtaccgcatcgcgaccgagccgccggcccagcggccgctgatc
atcgaccggatcacgtga

DBGET integrated database retrieval system